Lus10032570 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55290 101 / 3e-30 ATPase, V0 complex, subunit E (.1.2)
AT4G26710 90 / 9e-26 ATPase, V0 complex, subunit E (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043175 44 / 2e-06 AT5G55300 971 / 0.0 TOPOISOMERASE 1, MGOUN 1, DNA topoisomerase I alpha (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G092600 100 / 4e-30 AT5G55290 105 / 5e-32 ATPase, V0 complex, subunit E (.1.2)
Potri.001G359600 97 / 9e-29 AT5G55290 102 / 8e-31 ATPase, V0 complex, subunit E (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05493 ATP_synt_H ATP synthase subunit H
Representative CDS sequence
>Lus10032570 pacid=23146333 polypeptide=Lus10032570 locus=Lus10032570.g ID=Lus10032570.BGIv1.0 annot-version=v1.0
ATGGGGTTTTTGGTGACGACGCTGATCTTTGTAGTGGTCGGAATAATCGCCTCGCTCTGCGCACGAATCTGCTGTAACAGAGGACCCTCCACCAATTTGT
TGCATTTGACATTGGTTGTAACAGCAACAGTTAGCTGCTGGATGATGTGGGCTATTGTATATCTTGCACAGCTGAACCCACTGATTGTCCCAATCCTAAA
CGAAGCAGAGTAG
AA sequence
>Lus10032570 pacid=23146333 polypeptide=Lus10032570 locus=Lus10032570.g ID=Lus10032570.BGIv1.0 annot-version=v1.0
MGFLVTTLIFVVVGIIASLCARICCNRGPSTNLLHLTLVVTATVSCWMMWAIVYLAQLNPLIVPILNEAE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G55290 ATPase, V0 complex, subunit E ... Lus10032570 0 1
AT2G23940 Protein of unknown function (D... Lus10041903 1.4 0.9080
AT1G12390 Cornichon family protein (.1) Lus10004320 2.0 0.8790
AT5G54750 Transport protein particle (TR... Lus10028720 3.2 0.8478
AT5G11600 unknown protein Lus10001603 4.4 0.8216
AT5G61310 Cytochrome c oxidase subunit V... Lus10025028 4.6 0.8447
AT4G26965 NADH:ubiquinone oxidoreductase... Lus10032642 6.0 0.8448
AT2G25310 Protein of unknown function (D... Lus10001955 8.1 0.8733
AT5G65270 AtRABA4a RAB GTPase homolog A4A (.1) Lus10035924 11.8 0.8311
AT5G51510 unknown protein Lus10027200 12.6 0.8492
AT1G52280 AtRABG3d RAB GTPase homolog G3D (.1) Lus10035872 13.7 0.8327

Lus10032570 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.