Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G55290 101 / 3e-30 ATPase, V0 complex, subunit E (.1.2) AT4G26710 90 / 9e-26 ATPase, V0 complex, subunit E (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043175 [exp] 44 / 2e-06 AT5G55300 971 / 0.0 TOPOISOMERASE 1, MGOUN 1, DNA topoisomerase I alpha (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G092600 [exp] 100 / 4e-30 AT5G55290 105 / 5e-32 ATPase, V0 complex, subunit E (.1.2) Potri.001G359600 [exp] 97 / 9e-29 AT5G55290 102 / 8e-31 ATPase, V0 complex, subunit E (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05493 [flax] [poplar] ATP_synt_H ATP synthase subunit H
Representative CDS sequence Show only first row Show all	>Lus10032570 pacid=23146333 polypeptide=Lus10032570 locus=Lus10032570.g ID=Lus10032570.BGIv1.0 annot-version=v1.0 ATGGGGTTTTTGGTGACGACGCTGATCTTTGTAGTGGTCGGAATAATCGCCTCGCTCTGCGCACGAATCTGCTGTAACAGAGGACCCTCCACCAATTTGT TGCATTTGACATTGGTTGTAACAGCAACAGTTAGCTGCTGGATGATGTGGGCTATTGTATATCTTGCACAGCTGAACCCACTGATTGTCCCAATCCTAAA CGAAGCAGAGTAG
AA sequence Show only first row Show all	>Lus10032570 pacid=23146333 polypeptide=Lus10032570 locus=Lus10032570.g ID=Lus10032570.BGIv1.0 annot-version=v1.0 MGFLVTTLIFVVVGIIASLCARICCNRGPSTNLLHLTLVVTATVSCWMMWAIVYLAQLNPLIVPILNEAE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G55290			ATPase, V0 complex, subunit E ...		Lus10032570 [exp]	0	1
AT2G23940			Protein of unknown function (D...		Lus10041903 [exp]	1.4	0.9080
AT1G12390			Cornichon family protein (.1)		Lus10004320 [exp]	2.0	0.8790
AT5G54750			Transport protein particle (TR...		Lus10028720 [exp]	3.2	0.8478
AT5G11600			unknown protein		Lus10001603 [exp]	4.4	0.8216
AT5G61310			Cytochrome c oxidase subunit V...		Lus10025028 [exp]	4.6	0.8447
AT4G26965			NADH:ubiquinone oxidoreductase...		Lus10032642 [exp]	6.0	0.8448
AT2G25310			Protein of unknown function (D...		Lus10001955 [exp]	8.1	0.8733
AT5G65270		AtRABA4a	RAB GTPase homolog A4A (.1)		Lus10035924 [exp]	11.8	0.8311
AT5G51510			unknown protein		Lus10027200 [exp]	12.6	0.8492
AT1G52280		AtRABG3d	RAB GTPase homolog G3D (.1)		Lus10035872 [exp]	13.7	0.8327

Compare expression of checked genes

Lus10032570 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.