Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G55410 65 / 5e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G55460 62 / 7e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G55450 50 / 3e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48485 45 / 1e-07 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48490 42 / 3e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016582 [exp] 87 / 1e-23 AT5G55410 81 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10038233 [exp] 48 / 2e-08 AT5G48490 78 / 5e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10025866 [exp] 48 / 2e-08 AT5G48490 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10002741 [exp] 44 / 6e-07 AT5G48490 74 / 3e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G149900 [exp] 48 / 2e-08 AT5G48485 77 / 1e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G251000 [exp] 48 / 2e-08 AT5G48485 76 / 2e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G112553 [exp] 39 / 4e-05 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.T125404 [exp] 39 / 4e-05 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10032575 pacid=23146216 polypeptide=Lus10032575 locus=Lus10032575.g ID=Lus10032575.BGIv1.0 annot-version=v1.0 ATGCTGGTTTCAGCAGCGATGGCCACTGATCACCCCGACTCATCAGTGGTCACTGCTGCAAAACCGGTCAACAACTGTCGCGTTGATCCGTCCAGGCTCA TCGTCTGCAAGTCGGCTGTTACAGGGAAATATCCACCGCCTCCAACCGCCGAGTGCTGCAGACTGATGAGAAGGGCCAACTTGCCGTGCCTCTGTCGATT CAAGAGCTTCCTCCCTGCCTTTGGTATCGAACCGGCTCGCGCCATGGCTTTGCCCAAGAAATGTGGCCTCAAGCCTCCTCCATGCTGA
AA sequence Show only first row Show all	>Lus10032575 pacid=23146216 polypeptide=Lus10032575 locus=Lus10032575.g ID=Lus10032575.BGIv1.0 annot-version=v1.0 MLVSAAMATDHPDSSVVTAAKPVNNCRVDPSRLIVCKSAVTGKYPPPPTAECCRLMRRANLPCLCRFKSFLPAFGIEPARAMALPKKCGLKPPPC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G55410			Bifunctional inhibitor/lipid-t...		Lus10032575 [exp]	0	1
AT5G48490			Bifunctional inhibitor/lipid-t...		Lus10038233 [exp]	2.0	0.9815
AT3G60870	AT-hook	AHL18	AT-hook motif nuclear-localize...		Lus10009301 [exp]	2.4	0.9791
AT5G57090		MM31, ATPIN2, A...	WAVY ROOTS 6, ETHYLENE INSENSI...		Lus10001637 [exp]	2.4	0.9819
AT3G12120		FAD2	fatty acid desaturase 2 (.1.2)		Lus10021051 [exp]	3.5	0.9689
AT1G31710			Copper amine oxidase family pr...		Lus10013355 [exp]	3.7	0.9688
AT2G44380			Cysteine/Histidine-rich C1 dom...		Lus10003919 [exp]	4.0	0.9729
AT2G04400			Aldolase-type TIM barrel famil...		Lus10012310 [exp]	5.5	0.9657
AT2G45570		CYP76C2	"cytochrome P450, family 76, s...		Lus10027426 [exp]	5.9	0.9726
AT5G48490			Bifunctional inhibitor/lipid-t...		Lus10025866 [exp]	6.2	0.9607
AT4G10350	NAC	BRN2, NST4, ANA...	BEARSKIN 2, NAC domain contain...		Lus10039153 [exp]	7.2	0.9662

Compare expression of checked genes

Lus10032575 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.