Lus10032598 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13450 174 / 1e-54 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT2G03720 73 / 6e-16 MRH6 morphogenesis of root hair 6, Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT1G69080 65 / 1e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT5G17390 64 / 3e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G03290 63 / 1e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT1G44760 58 / 3e-10 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043152 361 / 6e-128 AT4G13450 178 / 4e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10014459 328 / 4e-115 AT4G13450 195 / 8e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10023716 225 / 4e-76 AT4G13450 136 / 2e-41 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10034661 63 / 7e-12 AT5G17390 160 / 3e-48 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10019173 58 / 5e-10 AT1G69080 192 / 2e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10036814 51 / 1e-08 AT1G69080 109 / 7e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10007982 54 / 2e-08 AT5G17390 149 / 1e-43 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10029664 52 / 4e-08 AT1G44760 236 / 2e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10042701 52 / 5e-08 AT1G44760 235 / 6e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G064800 204 / 9e-67 AT4G13450 194 / 4e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.008G109000 82 / 6e-19 AT1G69080 196 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.T170801 81 / 2e-18 AT1G69080 196 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.010G140200 76 / 2e-16 AT1G69080 202 / 3e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.015G060700 59 / 2e-10 AT3G03290 198 / 2e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.002G084600 55 / 6e-09 AT1G44760 200 / 5e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.005G177100 53 / 2e-08 AT1G44760 226 / 3e-75 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Lus10032598 pacid=23146372 polypeptide=Lus10032598 locus=Lus10032598.g ID=Lus10032598.BGIv1.0 annot-version=v1.0
ATGGGGTCGTTGCCGATGAAGAAAGTAATGGTGGTGGTGGATCCAAGCAGGGAGGCCGCCGGAGCGCTCCAATATGCATTGTCCCACGTCGTAACTGAGA
AAGACGAGCTTATCCTGGTTCACGTCGAAACACAAAATTCATGGAAGAACACCCTCACTTTCTCTTTTCTTCGTCGATCCGGCATCTCGATTCCGGCCAT
TAACAATAATAATAATAATAATAATAATCATCCATGTTCGACATCATCATCGGCGACGGAAGGAGGAGTCGGAGGGGGTGGTGGAGGAATGAACGGCGGA
GGAGGAGGAGGAGGAGAAGAGGAGGTTGATTTTTTGGAAGCGATGAAGCAGTTATGCGAGGCGGCAAAGCCAAGGCTGAAAGTGAAGGTGGAGAGGCTAC
AAATGGGAGCGAGGGACAAAGCTAGCGTCATTCTGTTCAAGAGCACTTCCATGGCGGTCGATCATCTCATCATTGGCCAAAAGAAGAACCTCTCCAGCAT
CTTACTAGGGACCACCAAATACAAAAAACCAGGAGGAATGGGGCCAAAGTCACTGGACATGGCAGAGTATTTGATCGAGTACAGCAAGTGCAATTGTATT
GGGGTGCAGAAGAAGGGGCAAAGTGGAGGTTATCTTCTCAACACTAAGACCCAGAAGAATTTTTGGCTCCTTGCTTAG
AA sequence
>Lus10032598 pacid=23146372 polypeptide=Lus10032598 locus=Lus10032598.g ID=Lus10032598.BGIv1.0 annot-version=v1.0
MGSLPMKKVMVVVDPSREAAGALQYALSHVVTEKDELILVHVETQNSWKNTLTFSFLRRSGISIPAINNNNNNNNNHPCSTSSSATEGGVGGGGGGMNGG
GGGGGEEEVDFLEAMKQLCEAAKPRLKVKVERLQMGARDKASVILFKSTSMAVDHLIIGQKKNLSSILLGTTKYKKPGGMGPKSLDMAEYLIEYSKCNCI
GVQKKGQSGGYLLNTKTQKNFWLLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G13450 Adenine nucleotide alpha hydro... Lus10032598 0 1
AT4G25950 VATG3 vacuolar ATP synthase G3 (.1) Lus10001543 7.1 0.8678
AT1G63460 ATGPX8 glutathione peroxidase 8 (.1) Lus10008534 13.7 0.8703
Lus10029087 29.2 0.8159
AT5G67360 ARA12 Subtilase family protein (.1) Lus10008921 31.3 0.8522
AT4G22860 Cell cycle regulated microtubu... Lus10031690 35.7 0.8428
AT1G07850 Protein of unknown function (D... Lus10036142 36.0 0.7429
AT3G19620 Glycosyl hydrolase family prot... Lus10002128 44.4 0.8370
AT1G02050 LAP6 LESS ADHESIVE POLLEN 6, Chalco... Lus10039904 50.8 0.8326
AT5G41460 Protein of unknown function (D... Lus10018123 51.9 0.8365
AT3G01650 RGLG1 RING domain ligase1 (.1) Lus10015079 56.7 0.8283

Lus10032598 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.