Lus10032601 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13600 158 / 1e-48 Carbohydrate-binding X8 domain superfamily protein (.1)
AT1G18650 110 / 8e-31 PDCB3 plasmodesmata callose-binding protein 3 (.1)
AT2G30933 102 / 3e-27 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT5G61130 100 / 1e-26 PDCB1 plasmodesmata callose-binding protein 1 (.1)
AT2G05790 104 / 3e-26 O-Glycosyl hydrolases family 17 protein (.1)
AT1G11820 103 / 7e-26 O-Glycosyl hydrolases family 17 protein (.1.2)
AT2G16230 102 / 1e-25 O-Glycosyl hydrolases family 17 protein (.1)
AT5G24318 101 / 3e-25 O-Glycosyl hydrolases family 17 protein (.1.2)
AT4G26830 100 / 4e-25 O-Glycosyl hydrolases family 17 protein (.1)
AT5G55180 100 / 5e-25 O-Glycosyl hydrolases family 17 protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021619 114 / 3e-31 AT1G18650 151 / 1e-45 plasmodesmata callose-binding protein 3 (.1)
Lus10021157 111 / 1e-30 AT1G18650 157 / 7e-49 plasmodesmata callose-binding protein 3 (.1)
Lus10040522 111 / 1e-30 AT1G18650 158 / 7e-49 plasmodesmata callose-binding protein 3 (.1)
Lus10034690 112 / 2e-30 AT1G18650 157 / 8e-48 plasmodesmata callose-binding protein 3 (.1)
Lus10037071 106 / 1e-28 AT1G18650 138 / 3e-41 plasmodesmata callose-binding protein 3 (.1)
Lus10036914 105 / 2e-28 AT1G18650 139 / 2e-41 plasmodesmata callose-binding protein 3 (.1)
Lus10007342 105 / 9e-28 AT2G30933 167 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10020765 103 / 4e-27 AT2G30933 169 / 4e-52 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10018306 106 / 6e-27 AT5G55180 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G055700 176 / 3e-56 AT4G13600 152 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.001G315700 173 / 6e-55 AT4G13600 155 / 2e-47 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.015G057800 116 / 1e-32 AT1G18650 151 / 3e-46 plasmodesmata callose-binding protein 3 (.1)
Potri.012G065750 115 / 3e-32 AT1G18650 142 / 1e-42 plasmodesmata callose-binding protein 3 (.1)
Potri.011G094400 110 / 2e-28 AT5G55180 635 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Potri.013G003500 108 / 1e-27 AT1G09460 144 / 3e-38 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.005G003500 108 / 1e-27 AT2G30933 142 / 1e-38 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.002G059600 103 / 3e-27 AT2G30933 164 / 5e-50 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.004G153800 104 / 2e-26 AT4G34480 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.007G111000 99 / 3e-26 AT4G05430 148 / 5e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07983 X8 X8 domain
Representative CDS sequence
>Lus10032601 pacid=23146439 polypeptide=Lus10032601 locus=Lus10032601.g ID=Lus10032601.BGIv1.0 annot-version=v1.0
ATGGCAGCATTGCCGTCTCTGCAATCTGCAGTATTGCTGATAATATTGTTGGTCAGGCTGCAGCTGGGAACCGTGGAGGCGACGTGGTGCGTGGCGAGGA
GCGACGCCAGCACCCAGGCTCTGCAGACGGCTCTGGACTACGCATGCTGGGCAGGAGCGGACTGCACTCCGATCCAGTCAAACGGACTCTGTTTCCTACC
CAACACGATACAGGCTCATGCTTCGTACGCGTTCAACAGCTACTTCCAGCGGAAGTCCATGGCCCCTGGCTCCTGCGACTTCTCCGGCACTGCTAACATC
GCCCGCACCGACCCCAGTTATGGTTCCTGCGTTTACCCCGGCTCCCTCAGCACGGCAGGAGGAGGGATCACGACTCCAACCACAACTCCAACAACTGCAG
ACATTCCCAACACTTGGACACCTCCGGGGACTATTCCGACAACCACGGGACTTACTCCGCCCATCTCTACCGACGAGGATGACTCCAGAGCTTCCATATT
TTCCACTGCCATAAACGTTGTAGCTCCTGTTGGCTGTGTGCTCATGATTCTTTTATTTTTAGAGTAA
AA sequence
>Lus10032601 pacid=23146439 polypeptide=Lus10032601 locus=Lus10032601.g ID=Lus10032601.BGIv1.0 annot-version=v1.0
MAALPSLQSAVLLIILLVRLQLGTVEATWCVARSDASTQALQTALDYACWAGADCTPIQSNGLCFLPNTIQAHASYAFNSYFQRKSMAPGSCDFSGTANI
ARTDPSYGSCVYPGSLSTAGGGITTPTTTPTTADIPNTWTPPGTIPTTTGLTPPISTDEDDSRASIFSTAINVVAPVGCVLMILLFLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G13600 Carbohydrate-binding X8 domain... Lus10032601 0 1
AT5G39420 CDC2CAT CDC2C (.1) Lus10005228 2.6 0.9207
AT1G67720 Leucine-rich repeat protein ki... Lus10037051 3.5 0.9127
AT3G15680 Ran BP2/NZF zinc finger-like s... Lus10002032 4.6 0.8907
AT5G50150 Protein of Unknown Function (D... Lus10042092 4.9 0.8882
AT2G35150 EXL7, EXL1 EXORDIUM LIKE 7, EXORDIUM like... Lus10017139 5.9 0.8798
AT1G43850 SEU SEUSS transcriptional co-regul... Lus10029594 6.3 0.8626
AT1G11915 unknown protein Lus10023362 8.1 0.8800
AT5G62890 Xanthine/uracil permease famil... Lus10010707 8.1 0.8843
AT5G12080 ATMSL10, MSL10 mechanosensitive channel of sm... Lus10019694 8.9 0.8667
AT5G65700 BAM1 BARELY ANY MERISTEM 1, Leucine... Lus10011585 10.4 0.8778

Lus10032601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.