Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23940 140 / 2e-40 dehydratase family (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033370 [exp] 145 / 3e-42 AT3G23940 1013 / 0.0 dehydratase family (.1.2) Lus10034822 [exp] 144 / 5e-42 AT3G23940 1009 / 0.0 dehydratase family (.1.2) Lus10043132 [exp] 145 / 6e-42 AT3G23940 1148 / 0.0 dehydratase family (.1.2) Lus10032616 [exp] 145 / 6e-42 AT3G23940 1162 / 0.0 dehydratase family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G051700 [exp] 142 / 2e-41 AT3G23940 960 / 0.0 dehydratase family (.1.2) Potri.003G176600 [exp] 142 / 3e-41 AT3G23940 1011 / 0.0 dehydratase family (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00920 [flax] [poplar] ILVD_EDD Dehydratase family
Representative CDS sequence Show only first row Show all	>Lus10032617 pacid=23146390 polypeptide=Lus10032617 locus=Lus10032617.g ID=Lus10032617.BGIv1.0 annot-version=v1.0 ATGCACTTGCTGAAGCTCTCCGAGGCGGTGAAGCTAGGGGTTCAAGATGCCGGGATGGTCGGGTTCAGGTTCAACACGATCGGGGTCAGCGATGCGATCT CTCAGGGGACGAGAGGGATGTGTTACAGCTTGCAGAGTAGGGACTTGATCGCTGATAGTATCGAGACCGTTGTGAGTGCTCAGTGTTACAGTGCTAATAT CTCCATTCCCGGCTGTGACAAGAATTACACCAAGAAGGTTCAATCAGCTTCAAAAGGCTGCGTGACAGACGAGTAA
AA sequence Show only first row Show all	>Lus10032617 pacid=23146390 polypeptide=Lus10032617 locus=Lus10032617.g ID=Lus10032617.BGIv1.0 annot-version=v1.0 MHLLKLSEAVKLGVQDAGMVGFRFNTIGVSDAISQGTRGMCYSLQSRDLIADSIETVVSAQCYSANISIPGCDKNYTKKVQSASKGCVTDE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23940			dehydratase family (.1.2)		Lus10032617 [exp]	0	1
AT5G56610			Phosphotyrosine protein phosph...		Lus10034998 [exp]	1.0	0.9484
					Lus10000363 [exp]	6.6	0.9454
					Lus10003285 [exp]	8.1	0.9454
					Lus10004996 [exp]	9.4	0.9454
AT2G25737			Sulfite exporter TauE/SafE fam...		Lus10022134 [exp]	10.5	0.9454
					Lus10025781 [exp]	11.5	0.9454
AT3G27080		TOM20-3	translocase of outer membrane ...		Lus10041558 [exp]	12.4	0.9454
AT1G20480			AMP-dependent synthetase and l...		Lus10011621 [exp]	13.3	0.9454
AT3G61150	HD	HD-GL2-1, HDG1	HOMEODOMAIN-GLABRA2 1, homeodo...		Lus10003300 [exp]	14.1	0.9454
AT2G37890			Mitochondrial substrate carrie...		Lus10006265 [exp]	14.8	0.9454

Compare expression of checked genes

Lus10032617 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.