Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G19810 105 / 3e-27 ChiC class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19820 97 / 8e-24 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19800 97 / 1e-23 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19760 81 / 4e-18 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19750 81 / 5e-18 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19720 77 / 7e-17 Glycosyl hydrolase family protein with chitinase insertion domain (.1) AT4G19730 74 / 1e-15 Glycosyl hydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019061 [exp] 241 / 1e-75 AT4G21380 338 / 5e-104 receptor kinase 3 (.1) Lus10040021 [exp] 107 / 3e-27 AT4G19810 278 / 5e-89 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10041639 [exp] 105 / 2e-26 AT4G11900 338 / 7e-104 S-locus lectin protein kinase family protein (.1) Lus10024081 [exp] 103 / 7e-26 AT1G61500 333 / 5e-102 S-locus lectin protein kinase family protein (.1) Lus10019060 [exp] 103 / 1e-25 AT4G19810 437 / 1e-149 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036310 [exp] 100 / 1e-25 AT4G19810 277 / 3e-92 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036315 [exp] 101 / 2e-25 AT4G19820 253 / 3e-81 Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10019601 [exp] 81 / 3e-20 AT4G19810 85 / 7e-21 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Lus10036306 [exp] 80 / 8e-18 AT4G19810 397 / 6e-138 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G111700 [exp] 130 / 4e-35 AT4G23200 363 / 1e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.018G111900 [exp] 128 / 2e-34 AT3G16030 367 / 2e-114 CALLUS EXPRESSION OF RBCS 101, lectin protein kinase family protein (.1) Potri.018G111800 [exp] 124 / 7e-33 AT4G23200 362 / 4e-115 cysteine-rich RLK (RECEPTOR-like protein kinase) 12 (.1) Potri.018G111600 [exp] 110 / 4e-28 AT4G23180 377 / 2e-120 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.006G188300 [exp] 92 / 6e-22 AT4G19810 379 / 2e-130 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.006G188400 [exp] 86 / 4e-20 AT4G19810 477 / 2e-169 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.006G262001 [exp] 71 / 1e-14 AT4G19810 283 / 2e-92 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.006G261800 [exp] 71 / 3e-14 AT4G19810 286 / 2e-92 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G112100 [exp] 69 / 5e-14 AT4G19810 279 / 3e-91 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1) Potri.018G112000 [exp] 68 / 2e-13 AT4G19810 284 / 3e-93 class V chitinase, Glycosyl hydrolase family protein with chitinase insertion domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF00704 [flax] [poplar] Glyco_hydro_18 Glycosyl hydrolases family 18
Representative CDS sequence Show only first row Show all	>Lus10032626 pacid=23146444 polypeptide=Lus10032626 locus=Lus10032626.g ID=Lus10032626.BGIv1.0 annot-version=v1.0 ATGGCTGCCGGAAACTCATTTATTCTTCTTCATCTCTCCTTCTTCTTCTTCTTCTTCTTCTTCCTCTCGTCCTTCCAGTTTCACTACTCAACAGCCGACC AACAGAAATGGATCAAATCCCCCTATTGGGATTCCGCCAGCTACTTCCCCGTAACCGGACTCAACTCTGCTCTCTTCACTCACCTCATCTGCGCCTTCGC CGGCGTAAGCTCCTCCACTTTCCACCTCTCCATCCCTCCCACTTCCCTCCCTGACTTCTCCACCTTCACCGTCACCGTCCGTCGCCGGAACCCCGGCGTC ACCACCCTCCTCTCCGTCCGGGACGCCGACCTGCCCTTCTCCGCCATGACCTCCACTCTTTCCCGCCGGAGCGCCTTCATCCGATCCTCAATCCAAACCG CTAGACTCTACGGCTTCCAAGGAATCGATTCGTTGACCCACAGTGCGGATGTAGGGAAGATAGAAATCCTAATTGAGGAATTCAGATCTGCGTTGAATCT GAAGCCGAGAAATCCAACAATTCGAAGCTCTTACTTACCATGGCGGTTCCAAGATCTCCGAACCTGA
AA sequence Show only first row Show all	>Lus10032626 pacid=23146444 polypeptide=Lus10032626 locus=Lus10032626.g ID=Lus10032626.BGIv1.0 annot-version=v1.0 MAAGNSFILLHLSFFFFFFFFLSSFQFHYSTADQQKWIKSPYWDSASYFPVTGLNSALFTHLICAFAGVSSSTFHLSIPPTSLPDFSTFTVTVRRRNPGV TTLLSVRDADLPFSAMTSTLSRRSAFIRSSIQTARLYGFQGIDSLTHSADVGKIEILIEEFRSALNLKPRNPTIRSSYLPWRFQDLRT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G19810		ChiC	class V chitinase, Glycosyl hy...		Lus10032626 [exp]	0	1
AT5G52200		AtI-2	inhibitor-2, phosphoprotein ph...		Lus10038872 [exp]	12.5	0.8504
AT3G08790			ENTH/VHS/GAT family protein (....		Lus10011689 [exp]	25.8	0.8402
AT2G36670			Eukaryotic aspartyl protease f...		Lus10027732 [exp]	39.0	0.8322
AT3G55960			Haloacid dehalogenase-like hyd...		Lus10028284 [exp]	42.3	0.8350
AT1G75560			zinc knuckle (CCHC-type) famil...		Lus10031093 [exp]	48.3	0.8258
AT1G09020		ATSNF4, SNF4	homolog of yeast sucrose nonfe...		Lus10015179 [exp]	54.8	0.8180
AT2G26040		RCAR14, PYL2	regulatory components of ABA r...		Lus10026430 [exp]	64.9	0.8152
AT1G14000		VIK	VH1-interacting kinase (.1)		Lus10030435 [exp]	67.8	0.7683
AT5G47790	FHA		SMAD/FHA domain-containing pro...		Lus10003911 [exp]	67.9	0.8192
AT4G35470		PIRL4, DREB1C	plant intracellular ras group-...		Lus10000900 [exp]	70.5	0.8123

Compare expression of checked genes

Lus10032626 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.