Lus10032642 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G26965 154 / 1e-47 NADH:ubiquinone oxidoreductase, 17.2kDa subunit (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G122100 177 / 1e-56 AT4G26965 217 / 1e-72 NADH:ubiquinone oxidoreductase, 17.2kDa subunit (.1.2)
Potri.001G109600 166 / 3e-52 AT4G26965 198 / 2e-65 NADH:ubiquinone oxidoreductase, 17.2kDa subunit (.1.2)
Potri.019G051400 40 / 0.0004 AT3G03100 269 / 1e-93 NADH:ubiquinone oxidoreductase, 17.2kDa subunit (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05071 NDUFA12 NADH ubiquinone oxidoreductase subunit NDUFA12
Representative CDS sequence
>Lus10032642 pacid=23146239 polypeptide=Lus10032642 locus=Lus10032642.g ID=Lus10032642.BGIv1.0 annot-version=v1.0
ATGTCGAAGCTTTTCGCAAGAATTTCTGGGTACTTCAGCAACCGGGCTCTGGCTGGGATGGACAGAGCAGGGAACCGATACTTCTCCAGAATTGAAGAGG
TTGATGGCGTAACGAAAGAGAAAAGATTTGTGATATTTAAAGGAGGAGAGCATGATCCAACTACAGTCCCAGTTGAATGGATATCCTGGCTAAATGGACA
GCGGAAAAAGGCTCCAACTCCTGAGGAAATGATGATGTTAGAAGCAAGGCGTGAACAAGTGAGGCAAAATGTTGCTCTTCTGAAGAAAGAAGAAGAGGAA
AGAAAAGTCAAAGAGGGAACTTCCCGTAAAGTCGTTACTACTGGTAAGGCAGACTTGAAGAGTTTCATGAGACAGTTAACGGCTGTTGGAGAAGGTCACT
TAGCTGAGAAGGAAGCAGAGGGGGCAGAAAGATTAAGACGCACGTTGAAGAAGAAGGAACAAATGGAAGCCAGAAAGGCAATGGTTACAACCGTGGTCGT
TCTTATTGTCATGATGACAACTGTGATGATTACCGGTTGCAACGCTGTTCGAGCTGTCGGCGACAACAACGACGCCACCAGTCAATCGTCGGAGCCAGCC
ATCCATGGTTTGATGTTACTCTTGTAA
AA sequence
>Lus10032642 pacid=23146239 polypeptide=Lus10032642 locus=Lus10032642.g ID=Lus10032642.BGIv1.0 annot-version=v1.0
MSKLFARISGYFSNRALAGMDRAGNRYFSRIEEVDGVTKEKRFVIFKGGEHDPTTVPVEWISWLNGQRKKAPTPEEMMMLEARREQVRQNVALLKKEEEE
RKVKEGTSRKVVTTGKADLKSFMRQLTAVGEGHLAEKEAEGAERLRRTLKKKEQMEARKAMVTTVVVLIVMMTTVMITGCNAVRAVGDNNDATSQSSEPA
IHGLMLLL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G26965 NADH:ubiquinone oxidoreductase... Lus10032642 0 1
AT5G17060 ATARFB1B ADP-ribosylation factor B1B (.... Lus10009571 3.3 0.8681
AT2G19790 SNARE-like superfamily protein... Lus10035004 4.9 0.8599
AT1G26550 FKBP-like peptidyl-prolyl cis-... Lus10019084 5.5 0.8564
AT5G55290 ATPase, V0 complex, subunit E ... Lus10032570 6.0 0.8448
AT1G07960 ATPDIL5-1 PDI-like 5-1 (.1.2.3) Lus10036125 6.3 0.8528
AT1G76200 unknown protein Lus10012279 12.4 0.8385
AT3G45020 Ribosomal L18p/L5e family prot... Lus10021433 13.0 0.8484
AT1G64750 DSS1(I), ATDSS1... deletion of SUV3 suppressor 1(... Lus10030583 13.7 0.8315
AT4G17360 Formyl transferase (.1) Lus10007482 14.7 0.7882
AT3G03070 NADH-ubiquinone oxidoreductase... Lus10039147 15.5 0.8257

Lus10032642 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.