Lus10032643 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G54970 59 / 4e-12 unknown protein
AT4G26960 55 / 2e-10 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043108 202 / 2e-68 AT5G54970 66 / 2e-14 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G052300 59 / 3e-12 AT5G54970 60 / 2e-12 unknown protein
PFAM info
Representative CDS sequence
>Lus10032643 pacid=23146351 polypeptide=Lus10032643 locus=Lus10032643.g ID=Lus10032643.BGIv1.0 annot-version=v1.0
ATGGTGGCCCCTTCCAGATCTCCCAACCAACCCCACTGTTGCTTCCACCGCTACCTCAAGCCGGGAGCCCTCGCCCGTCTCAGAGACTCCAGAATCGGCG
CCGCCAGATCTCTTCAACCCAAGAAGTCCCCTCCTCCCGCCGATCTTCAAACTCCGATGCAATCTGCTGACGATGATAATGATATTCCCTTCCTTTTGGC
CAAGCTCTACAGACCCCAATCCCTAAACAGGAAGAGACTCGTCGCCGCTAGATCTGTTCTGTTCGCCGGGTTGCCTTCTCCTTCCAATCCGGCGTTGGAT
CTGACCAATCGAGGCGATGGTGGTATCAGTCATAGCAATAGTAATAATGGGTCTACGATGGCTGCGTTGAATAGCGATGCAGTTGTTGTCGCTCATTGA
AA sequence
>Lus10032643 pacid=23146351 polypeptide=Lus10032643 locus=Lus10032643.g ID=Lus10032643.BGIv1.0 annot-version=v1.0
MVAPSRSPNQPHCCFHRYLKPGALARLRDSRIGAARSLQPKKSPPPADLQTPMQSADDDNDIPFLLAKLYRPQSLNRKRLVAARSVLFAGLPSPSNPALD
LTNRGDGGISHSNSNNGSTMAALNSDAVVVAH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G54970 unknown protein Lus10032643 0 1
AT5G40830 ATRAD3, ATATR S-adenosyl-L-methionine-depend... Lus10007385 2.0 0.9672
AT1G62500 Bifunctional inhibitor/lipid-t... Lus10032262 4.6 0.9508
Lus10042887 5.1 0.9509
AT5G55130 SIR1, CNX5 SIRTINOL RESISTANT 1, "co-fact... Lus10022510 6.0 0.9470
AT2G45290 Transketolase (.1) Lus10004750 8.1 0.9487
AT3G63250 HMT-2, ATHMT-2 ... HOMOCYSTEINE METHYLTRANSFERASE... Lus10006901 10.0 0.9421
AT2G37270 ATRPS5B ribosomal protein 5B (.1.2) Lus10000946 11.5 0.9489
AT2G28720 Histone superfamily protein (.... Lus10028826 13.0 0.9124
AT5G52860 ABCG8 ATP-binding cassette G8, ABC-2... Lus10027545 13.4 0.9219
AT2G35350 PLL1 poltergeist like 1 (.1) Lus10004554 13.9 0.9303

Lus10032643 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.