Lus10032648 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16890 224 / 3e-69 PPR40 pentatricopeptide (PPR) domain protein 40 (.1)
AT1G09820 136 / 8e-37 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G05670 136 / 1e-36 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
AT5G16640 130 / 4e-35 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G53700 130 / 9e-35 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G11690 130 / 1e-34 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G74580 129 / 3e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G59900 127 / 1e-33 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G12700 127 / 1e-33 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
AT3G16710 126 / 1e-33 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043104 462 / 1e-161 AT3G16890 720 / 0.0 pentatricopeptide (PPR) domain protein 40 (.1)
Lus10010410 135 / 2e-36 AT5G59900 998 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013283 131 / 4e-35 AT1G05670 785 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Lus10036865 129 / 6e-35 AT1G12700 273 / 1e-83 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10016727 129 / 2e-34 AT5G61990 345 / 2e-108 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10012139 129 / 3e-34 AT5G59900 987 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10036020 129 / 4e-34 AT5G61990 592 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10012068 127 / 2e-33 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027914 125 / 1e-32 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G108300 255 / 2e-80 AT3G16890 771 / 0.0 pentatricopeptide (PPR) domain protein 40 (.1)
Potri.013G034300 134 / 8e-37 AT1G62930 397 / 4e-133 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G257300 135 / 2e-36 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G242200 135 / 2e-36 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G032600 135 / 2e-36 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G271200 134 / 2e-36 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.007G068400 132 / 3e-36 AT3G22470 300 / 8e-96 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G074500 134 / 4e-36 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.014G166001 133 / 5e-36 AT4G26680 697 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.019G021200 133 / 5e-36 AT1G12700 491 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10032648 pacid=23146394 polypeptide=Lus10032648 locus=Lus10032648.g ID=Lus10032648.BGIv1.0 annot-version=v1.0
ATGGTGAAAGCTGGCTTTCTGGCTACTGCTGTTTCCTATAACATGGTGATTGATTGTTTGTGCAAAGTTAATAAGATAGACAAAGCAGACAAAGTTTTCC
AAGAGATGCAGCAAAAAGGTATCACCCCGAACCTTGTTACATTCAACACTCTTCTAAGTGGTTATTGCAAGAATGGAGAGGTTCGTGGGGCCAGGAAACT
GTTGGAGATGCTCTTAGAATACGGGTTTAAACCAGACATATTCACTTTTACTTCAATAATCGATGGCCTTTCCCGAGTAAAACATCTTGAGGATGCATTA
GGCTGTTTCAGGGAAATGGTAGAGTGGGGTGTCTCTCCTAATGCTGTGACGTACAATATATTGCTGCGATCCCTGGCTGTCAATGGTGATGTTGCTGGTT
CTATTGAAATCTTAAGGAAGATGCAAAGAGATGGAATAGATCCTGATGTTTCTGCCTTCAATGCTCTCGTCCAACGTTTTTGTAGGATGGGAAAAGTGAA
GAAAGCACATAACCTTTTTGCTTCCATGCTGGCATTAAATTTGGTTCCTGATACTCATATGAAGACACTCTCTGAATTAAGGAGACCTGATGAAGCCAAG
GAGATACTTGACTCCATGGAAGCTAATAGTTCTCTTCCAGACATGCAATTTGATTGTGGACAATCTACTCCGGCAGGGCCACTATGTCGAAGCTGA
AA sequence
>Lus10032648 pacid=23146394 polypeptide=Lus10032648 locus=Lus10032648.g ID=Lus10032648.BGIv1.0 annot-version=v1.0
MVKAGFLATAVSYNMVIDCLCKVNKIDKADKVFQEMQQKGITPNLVTFNTLLSGYCKNGEVRGARKLLEMLLEYGFKPDIFTFTSIIDGLSRVKHLEDAL
GCFREMVEWGVSPNAVTYNILLRSLAVNGDVAGSIEILRKMQRDGIDPDVSAFNALVQRFCRMGKVKKAHNLFASMLALNLVPDTHMKTLSELRRPDEAK
EILDSMEANSSLPDMQFDCGQSTPAGPLCRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G16890 PPR40 pentatricopeptide (PPR) domain... Lus10032648 0 1
AT2G29760 OTP81 ORGANELLE TRANSCRIPT PROCESSIN... Lus10020918 2.0 0.8566
AT3G16890 PPR40 pentatricopeptide (PPR) domain... Lus10043104 18.2 0.8476
AT5G63290 Radical SAM superfamily protei... Lus10001104 22.4 0.8218
AT4G38430 ATROPGEF1, ROPG... rho guanyl-nucleotide exchange... Lus10025101 24.6 0.8210
AT2G37310 Pentatricopeptide repeat (PPR)... Lus10025273 25.8 0.8249
AT5G56590 O-Glycosyl hydrolases family 1... Lus10034987 30.7 0.8073
AT2G35540 DNAJ heat shock N-terminal dom... Lus10027316 34.5 0.8123
AT5G08340 Nucleotidylyl transferase supe... Lus10028973 40.4 0.7655
AT5G55540 LOP1, TRN1 LOPPED 1, tornado 1 (.1) Lus10016591 40.7 0.8029
AT3G06010 ATCHR12 Homeotic gene regulator (.1) Lus10010522 40.8 0.8227

Lus10032648 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.