Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10480 102 / 4e-27 NAC ANAC050 NAC domain containing protein 50 (.1.2.3) AT3G10490 98 / 6e-27 NAC ANAC051, ANAC052 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2) AT5G04410 91 / 6e-23 NAC NAC2, ANAC078 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1) AT3G10500 87 / 1e-21 NAC ANAC053 NAC domain containing protein 53 (.1) AT1G33060 87 / 1e-21 NAC ANAC014 NAC 014 (.1.2) AT5G61430 83 / 2e-20 NAC ANAC100, ATNAC5 NAC domain containing protein 100 (.1) AT5G07680 82 / 3e-20 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2) AT4G35580 83 / 5e-20 NAC NTL9, CBNAC NAC transcription factor-like 9 (.1.2.3) AT2G33480 79 / 2e-19 NAC ANAC041 NAC domain containing protein 41 (.1.2) AT3G29035 79 / 3e-19 NAC ORS1, AtNAC3, ANAC059 ORE1 SISTER1, Arabidopsis NAC domain containing protein 59, NAC domain containing protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038670 [exp] 135 / 2e-38 AT3G10490 441 / 5e-143 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2) Lus10037939 [exp] 130 / 5e-38 AT3G10490 415 / 2e-143 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2) Lus10023537 [exp] 120 / 5e-34 AT3G10490 331 / 2e-110 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2) Lus10032919 [exp] 88 / 8e-22 AT5G24590 314 / 7e-102 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Lus10017458 [exp] 87 / 1e-21 AT5G04410 379 / 8e-126 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1) Lus10015587 [exp] 87 / 2e-21 AT5G24590 306 / 9e-99 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Lus10028824 [exp] 84 / 2e-20 AT5G04410 378 / 5e-125 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1) Lus10021659 [exp] 81 / 2e-19 AT5G61430 361 / 8e-125 NAC domain containing protein 100 (.1) Lus10001648 [exp] 80 / 3e-19 AT5G61430 359 / 4e-124 NAC domain containing protein 100 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G229700 [exp] 117 / 1e-32 AT3G10480 418 / 8e-144 NAC domain containing protein 50 (.1.2.3) Potri.008G031800 [exp] 96 / 8e-25 AT5G04410 511 / 6e-177 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1) Potri.015G004100 [exp] 90 / 1e-22 AT3G49530 309 / 5e-99 NTM1 \(NAC WITH TRANSMEMBRANE MOTIF 1\)-LIKE 6, NAC domain containing protein 62 (.1) Potri.012G007500 [exp] 89 / 3e-22 AT5G24590 306 / 4e-98 Arabidopsis NAC domain containing protein 91, TCV-interacting protein (.2) Potri.010G229900 [exp] 87 / 2e-21 AT5G04410 481 / 4e-165 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1) Potri.017G086200 [exp] 82 / 6e-20 AT5G61430 386 / 2e-134 NAC domain containing protein 100 (.1) Potri.012G001400 [exp] 81 / 1e-19 AT5G61430 448 / 1e-158 NAC domain containing protein 100 (.1) Potri.005G098200 [exp] 80 / 2e-19 AT1G56010 332 / 6e-114 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Potri.012G038100 [exp] 79 / 2e-19 AT3G17730 339 / 4e-118 NAC domain containing protein 57 (.1) Potri.015G020000 [exp] 80 / 4e-19 AT5G61430 446 / 1e-157 NAC domain containing protein 100 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10032653 pacid=23146264 polypeptide=Lus10032653 locus=Lus10032653.g ID=Lus10032653.BGIv1.0 annot-version=v1.0 ATGAACAGAGCCACCGGCAAAGGTTACTGGAAAGCCCCCGGGAAAGACCGGGAAATTCGTCGAGACAACCAGCTTTTAGCTATGAAGAAGACCCTTGTGT TTCTTAGTGGACGCTCCCCTGGTGGCCAGCGCACTAATTGGGTTATGCATGAGCACCGTCTAGTTGACGAGGAGTTGGAAAGAATTGGCACTTTTGCAGG TGAGAATAGAGTTGGTAGAGAAACTCAGCATCACCTTGAAAGTCAGACGCGAGAACCCTCTTAA
AA sequence Show only first row Show all	>Lus10032653 pacid=23146264 polypeptide=Lus10032653 locus=Lus10032653.g ID=Lus10032653.BGIv1.0 annot-version=v1.0 MNRATGKGYWKAPGKDREIRRDNQLLAMKKTLVFLSGRSPGGQRTNWVMHEHRLVDEELERIGTFAGENRVGRETQHHLESQTREPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G10480	NAC	ANAC050	NAC domain containing protein ...		Lus10032653 [exp]	0	1
AT1G27190			Leucine-rich repeat protein ki...		Lus10010615 [exp]	1.4	0.7514
AT5G46100			Pentatricopeptide repeat (PPR)...		Lus10015397 [exp]	8.8	0.6255
AT3G54120			Reticulon family protein (.1)		Lus10035537 [exp]	15.3	0.6709
AT4G32840		PFK6	phosphofructokinase 6 (.1)		Lus10005488 [exp]	35.4	0.6356
AT3G27530		MAG4, GC6	MAIGO 4, golgin candidate 6 (....		Lus10000216 [exp]	43.4	0.5559
AT2G37500			arginine biosynthesis protein ...		Lus10023757 [exp]	51.8	0.5377
AT1G01420		UGT72B3	UDP-glucosyl transferase 72B3 ...		Lus10005334 [exp]	53.5	0.6017
AT4G39420			unknown protein		Lus10008760 [exp]	56.0	0.6113
AT2G41660		MIZ1	mizu-kussei 1, Protein of unkn...		Lus10042046 [exp]	72.4	0.5792
AT2G40740	WRKY	ATWRKY55, WRKY5...	WRKY DNA-binding protein 55 (....		Lus10029022 [exp]	75.7	0.5696

Compare expression of checked genes

Lus10032653 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.