Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15518 61 / 5e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043096 [exp] 130 / 2e-40 AT3G15518 61 / 2e-13 unknown protein Lus10037893 [exp] 57 / 1e-11 AT3G15518 64 / 2e-14 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G123600 [exp] 57 / 7e-12 AT3G15518 64 / 2e-14 unknown protein Potri.001G404500 [exp] 56 / 3e-11 AT3G15518 66 / 2e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032656 pacid=23146396 polypeptide=Lus10032656 locus=Lus10032656.g ID=Lus10032656.BGIv1.0 annot-version=v1.0 ATGGGCGGTATTGACGTGGCGCAGTCGGCGGAAGGGAGCCGTCGAGGAGGCGGCAGAAGTAGTAGCAGTAATTATACCAGTGGCGGCGTTGTTCGCGGCG GAGGGGCATTTTCGGCGAGGGTGATGAGGACGTCGTCGGCGGGGAGGTGCGGGAGCGTCCGGCCGCAACGTAGCGCTATCCCACCACCAAGTAGTAGGAT TCGGCATCATCATCGTCATCAGGCGGCGGGTAGTAGGGAGGTGTTGAGAAGGGCGTTGATGCCGCCCAGCCGGCGGCCTAGTCTCCGGTGGGTGAATTTC CGGCCTTCTCCTAGTCGTCTATGTAACATGTCAATGGCCCCCTGA
AA sequence Show only first row Show all	>Lus10032656 pacid=23146396 polypeptide=Lus10032656 locus=Lus10032656.g ID=Lus10032656.BGIv1.0 annot-version=v1.0 MGGIDVAQSAEGSRRGGGRSSSSNYTSGGVVRGGGAFSARVMRTSSAGRCGSVRPQRSAIPPPSSRIRHHHRHQAAGSREVLRRALMPPSRRPSLRWVNF RPSPSRLCNMSMAP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15518			unknown protein		Lus10032656 [exp]	0	1
AT1G01480		AT-ACC2, ACS2	1-amino-cyclopropane-1-carboxy...		Lus10032301 [exp]	5.4	0.9383
AT1G69670		CUL3B, ATCUL3B	ARABIDOPSIS THALIANA CULLIN 3B...		Lus10009610 [exp]	23.9	0.8991
AT3G09032			unknown protein		Lus10035520 [exp]	68.2	0.8705
					Lus10008211 [exp]	96.3	0.8849
AT1G65520		PEC11, ECHIC, A...	"delta\(3\), delta\(2\)-enoyl ...		Lus10001701 [exp]	264.3	0.8518
AT3G59080			Eukaryotic aspartyl protease f...		Lus10007335 [exp]	271.0	0.8510

Compare expression of checked genes

Lus10032656 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.