Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043090 [exp] 64 / 8e-14 AT5G54190 652 / 0.0 protochlorophyllide oxidoreductase A (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G122400 [exp] 41 / 9e-06 AT5G54190 592 / 0.0 protochlorophyllide oxidoreductase A (.1.2) Potri.001G403300 [exp] 41 / 1e-05 AT5G54190 555 / 0.0 protochlorophyllide oxidoreductase A (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032664 pacid=23146418 polypeptide=Lus10032664 locus=Lus10032664.g ID=Lus10032664.BGIv1.0 annot-version=v1.0 ATGGCTCTCTCCTCAGCCGCTTCACTGGTTTCCTCTGCTTTCGTCGCTCCCAAAGAGGTTAAATCGAGTGCTTCTTCTTTTGGAGTCTCACTCTACGACC ATGTCAAACCTGACTTCACTTCTTCTGCACTCAGATGCATTAATAATTTGAACTTTCGAGTGAACTTGAAAGCAACATTGGTCGAAATTTAA
AA sequence Show only first row Show all	>Lus10032664 pacid=23146418 polypeptide=Lus10032664 locus=Lus10032664.g ID=Lus10032664.BGIv1.0 annot-version=v1.0 MALSSAASLVSSAFVAPKEVKSSASSFGVSLYDHVKPDFTSSALRCINNLNFRVNLKATLVEI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10032664 [exp]	0	1
AT5G54190		PORA	protochlorophyllide oxidoreduc...		Lus10043090 [exp]	2.4	0.9183
AT2G27130			Bifunctional inhibitor/lipid-t...		Lus10026768 [exp]	8.9	0.8530
AT3G57800	bHLH	bHLH060	basic helix-loop-helix (bHLH) ...		Lus10040506 [exp]	11.2	0.8420
AT3G26744	bHLH	SCRM, ATICE1, I...	SCREAM, A. THALIANA INDUCER OF...		Lus10032542 [exp]	12.8	0.8850
AT1G34110			Leucine-rich receptor-like pro...		Lus10017782 [exp]	12.8	0.8591
AT5G37020	ARF	ARF8, ATARF8	auxin response factor 8 (.1.2)		Lus10007386 [exp]	16.2	0.8552
AT1G56460			HIT zinc finger ;PAPA-1-like c...		Lus10037760 [exp]	20.1	0.8439
AT4G26370			antitermination NusB domain-co...		Lus10013400 [exp]	20.2	0.8746
AT5G54190		PORA	protochlorophyllide oxidoreduc...		Lus10032665 [exp]	21.6	0.8639
AT3G52150			RNA-binding (RRM/RBD/RNP motif...		Lus10041602 [exp]	29.7	0.8530

Compare expression of checked genes

Lus10032664 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.