Lus10032668 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15410 242 / 6e-77 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2)
AT4G35470 96 / 1e-22 PIRL4, DREB1C plant intracellular ras group-related LRR 4 (.1)
AT2G17440 86 / 4e-19 PIRL5 plant intracellular ras group-related LRR 5 (.1)
AT3G11330 82 / 4e-18 PIRL9 plant intracellular ras group-related LRR 9 (.1)
AT3G26500 78 / 2e-16 PIRL2 plant intracellular ras group-related LRR 2 (.1)
AT3G11010 78 / 2e-16 AtRLP34 receptor like protein 34 (.1)
AT4G26050 77 / 3e-16 PIRL8 plant intracellular ras group-related LRR 8 (.1)
AT2G19330 77 / 3e-16 PIRL6 plant intracellular ras group-related LRR 6 (.1)
AT5G05850 77 / 4e-16 PIRL1 plant intracellular ras group-related LRR 1 (.1)
AT1G12970 76 / 1e-15 PIRL3 plant intracellular ras group-related LRR 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043086 141 / 8e-40 AT3G15410 497 / 2e-173 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2)
Lus10035976 103 / 3e-25 AT4G35470 652 / 0.0 plant intracellular ras group-related LRR 4 (.1)
Lus10016684 100 / 8e-24 AT1G55325 733 / 0.0 MACCHI-BOU 2, GRAND CENTRAL, RNA polymerase II transcription mediators (.1.2)
Lus10000900 94 / 3e-22 AT4G35470 409 / 2e-138 plant intracellular ras group-related LRR 4 (.1)
Lus10021635 81 / 4e-18 AT5G07910 360 / 6e-127 Leucine-rich repeat (LRR) family protein (.1)
Lus10013689 78 / 2e-16 AT3G11330 473 / 3e-165 plant intracellular ras group-related LRR 9 (.1)
Lus10017948 77 / 4e-16 AT3G11330 557 / 0.0 plant intracellular ras group-related LRR 9 (.1)
Lus10023677 76 / 7e-16 AT5G48940 1361 / 0.0 Leucine-rich repeat transmembrane protein kinase family protein (.1)
Lus10000681 74 / 9e-16 AT5G07910 357 / 2e-125 Leucine-rich repeat (LRR) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G121700 268 / 6e-87 AT3G15410 749 / 0.0 Leucine-rich repeat (LRR) family protein (.1), Leucine-rich repeat (LRR) family protein (.2)
Potri.005G098600 98 / 2e-23 AT4G35470 672 / 0.0 plant intracellular ras group-related LRR 4 (.1)
Potri.003G090100 93 / 1e-21 AT2G17440 416 / 2e-140 plant intracellular ras group-related LRR 5 (.1)
Potri.007G065000 93 / 1e-21 AT4G35470 693 / 0.0 plant intracellular ras group-related LRR 4 (.1)
Potri.001G144100 84 / 1e-18 AT4G35470 448 / 6e-153 plant intracellular ras group-related LRR 4 (.1)
Potri.015G083800 84 / 2e-18 AT3G11330 471 / 9e-163 plant intracellular ras group-related LRR 9 (.1)
Potri.010G046500 82 / 4e-18 AT1G12970 493 / 7e-173 plant intracellular ras group-related LRR 3 (.1)
Potri.015G048800 76 / 2e-16 AT5G07910 341 / 2e-119 Leucine-rich repeat (LRR) family protein (.1)
Potri.011G139700 76 / 7e-16 AT1G17230 1363 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Potri.004G049100 76 / 1e-15 AT1G28440 1387 / 0.0 HAESA-like 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
Representative CDS sequence
>Lus10032668 pacid=23146259 polypeptide=Lus10032668 locus=Lus10032668.g ID=Lus10032668.BGIv1.0 annot-version=v1.0
ATGGATCGAGCACTCAAAGCTGCTAGAGCTTCTGGTTCTCTCAACCTCTCCAATCGCTCTCTAAGGCAAGTTCCCCAAACCCTGACTAGTTCCGGTTCAT
TATTTTGTTCCGTCTGCGATGACCGATCGCTTCCTAATCCCATTTGGATTCCAGAGATGTTTTTGGCTCATAACAACATAGAGTCATTGAAGGAAGATCT
GAGAAACTTGAGTCAATTGACTGTGCTTAATGTTAGCAACAACAAGCTCCACGAGCTCCCCTCTGCTATTGGAGAGCTTCCTATGCTTAAGTCTTTAGAT
CTGTCATTTAACTTGATTATCAAAATACCCGAAGAAATTGGATCGGCAACTTCTCTTGTCAAGTTGGATTGTTCAAGCAATAGGCTCTCTGAACTTCCTG
CTTCACTTGGAAGATGCGTGGATCTGTCTGATCTCAAGGCATCGAAGAATTGTATCAGTAGCTTGCCAGACGAGCTAGCCAATTGTTCAAAACTGACAAA
ATTAGATGTGGAGGGTAACAAGCTCAGGAATTTGTCTGGCAATATGGTGGCATCATGGACCAAGCTTACAGAACTTAATGCAGCAAAGAACTTGCTGAGT
GGTCTACCAGACAATTTAGGAAATTTGTCAAAGCTCATCCGCCTGGACCTTCATCAAAACAGTGAGTGA
AA sequence
>Lus10032668 pacid=23146259 polypeptide=Lus10032668 locus=Lus10032668.g ID=Lus10032668.BGIv1.0 annot-version=v1.0
MDRALKAARASGSLNLSNRSLRQVPQTLTSSGSLFCSVCDDRSLPNPIWIPEMFLAHNNIESLKEDLRNLSQLTVLNVSNNKLHELPSAIGELPMLKSLD
LSFNLIIKIPEEIGSATSLVKLDCSSNRLSELPASLGRCVDLSDLKASKNCISSLPDELANCSKLTKLDVEGNKLRNLSGNMVASWTKLTELNAAKNLLS
GLPDNLGNLSKLIRLDLHQNSE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G15410 Leucine-rich repeat (LRR) fami... Lus10032668 0 1
AT1G73920 alpha/beta-Hydrolases superfam... Lus10042973 6.3 0.8360
AT5G20490 XI-17, ATXIK, X... MYOSIN XI-17, MYOSIN XI K, Myo... Lus10003315 7.7 0.8501
AT4G01210 glycosyl transferase family 1 ... Lus10008732 9.9 0.8104
AT3G45850 P-loop containing nucleoside t... Lus10036146 11.7 0.8046
AT4G10570 UBP9 ubiquitin-specific protease 9 ... Lus10001661 15.9 0.7812
AT4G02030 Vps51/Vps67 family (components... Lus10041387 16.3 0.7951
AT1G10120 bHLH bHLH074, CIB4 basic helix-loop-helix (bHLH) ... Lus10012484 16.4 0.7604
AT5G19390 Rho GTPase activation protein ... Lus10036047 17.5 0.7894
AT2G19600 ATKEA4 K+ efflux antiporter 4, K+ eff... Lus10040549 18.4 0.7577
AT1G14740 Protein of unknown function (D... Lus10030771 24.1 0.6877

Lus10032668 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.