Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20630 89 / 2e-23 PIA1 PP2C induced by AVRRPM1 (.1.2) AT1G34750 86 / 2e-22 Protein phosphatase 2C family protein (.1) AT1G78200 86 / 4e-22 Protein phosphatase 2C family protein (.1.2) AT4G28400 85 / 6e-22 Protein phosphatase 2C family protein (.1) AT1G22280 84 / 2e-21 PAPP2C phytochrome-associated protein phosphatase type 2C (.1.2.3) AT3G15260 81 / 3e-20 Protein phosphatase 2C family protein (.1.2) AT4G31750 76 / 2e-18 WIN2 HOPW1-1-interacting 2 (.1) AT3G23360 74 / 7e-18 Protein phosphatase 2C family protein (.1) AT5G10740 72 / 9e-17 Protein phosphatase 2C family protein (.1) AT5G24940 72 / 9e-17 Protein phosphatase 2C family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008556 [exp] 120 / 2e-35 AT4G28400 352 / 1e-122 Protein phosphatase 2C family protein (.1) Lus10040565 [exp] 113 / 1e-32 AT4G28400 359 / 1e-125 Protein phosphatase 2C family protein (.1) Lus10028094 [exp] 112 / 2e-32 AT4G28400 360 / 8e-126 Protein phosphatase 2C family protein (.1) Lus10033453 [exp] 91 / 3e-24 AT1G34750 369 / 7e-130 Protein phosphatase 2C family protein (.1) Lus10020924 [exp] 90 / 1e-23 AT1G34750 438 / 7e-157 Protein phosphatase 2C family protein (.1) Lus10009210 [exp] 84 / 3e-21 AT3G15260 300 / 4e-101 Protein phosphatase 2C family protein (.1.2) Lus10018618 [exp] 82 / 8e-21 AT4G28400 427 / 2e-152 Protein phosphatase 2C family protein (.1) Lus10039853 [exp] 81 / 3e-20 AT4G28400 427 / 2e-152 Protein phosphatase 2C family protein (.1) Lus10042430 [exp] 78 / 2e-19 AT4G31750 452 / 2e-162 HOPW1-1-interacting 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G150800 [exp] 117 / 3e-34 AT4G28400 340 / 1e-117 Protein phosphatase 2C family protein (.1) Potri.006G081400 [exp] 112 / 3e-32 AT4G28400 348 / 3e-121 Protein phosphatase 2C family protein (.1) Potri.005G164600 [exp] 88 / 4e-23 AT1G34750 450 / 1e-161 Protein phosphatase 2C family protein (.1) Potri.017G013300 [exp] 87 / 1e-22 AT4G28400 439 / 2e-157 Protein phosphatase 2C family protein (.1) Potri.002G097200 [exp] 86 / 3e-22 AT1G34750 449 / 2e-161 Protein phosphatase 2C family protein (.1) Potri.011G116700 [exp] 86 / 3e-22 AT3G15260 439 / 5e-157 Protein phosphatase 2C family protein (.1.2) Potri.001G398100 [exp] 85 / 8e-22 AT3G15260 469 / 7e-169 Protein phosphatase 2C family protein (.1.2) Potri.006G267600 [exp] 79 / 9e-20 AT4G31750 535 / 0.0 HOPW1-1-interacting 2 (.1) Potri.018G013900 [exp] 79 / 1e-19 AT4G31750 533 / 0.0 HOPW1-1-interacting 2 (.1) Potri.010G070100 [exp] 74 / 8e-18 AT3G23360 224 / 7e-73 Protein phosphatase 2C family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0238 [flax] [poplar] PP2C PF00481 [flax] [poplar] PP2C Protein phosphatase 2C
Representative CDS sequence Show only first row Show all	>Lus10032673 pacid=23158938 polypeptide=Lus10032673 locus=Lus10032673.g ID=Lus10032673.BGIv1.0 annot-version=v1.0 ATGGACTTTGTTATATTAGCAAGTGATGGCTTGTGGAAGGTGATGAAGAACCAAGAGGCGGTAGATTTGGTGAAGCCTATAAAGGATCCTCAGGCAGCAG CCAAGCGACTGACAACAGAGGCATTGGCTAGAAACAGCAAAGACGACATATCGTGCATAGTGATCCGCTTCGGATGA
AA sequence Show only first row Show all	>Lus10032673 pacid=23158938 polypeptide=Lus10032673 locus=Lus10032673.g ID=Lus10032673.BGIv1.0 annot-version=v1.0 MDFVILASDGLWKVMKNQEAVDLVKPIKDPQAAAKRLTTEALARNSKDDISCIVIRFG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20630		PIA1	PP2C induced by AVRRPM1 (.1.2)		Lus10032673 [exp]	0	1
AT1G07570		APK1A	Protein kinase superfamily pro...		Lus10002697 [exp]	1.0	0.9631
AT4G28400			Protein phosphatase 2C family ...		Lus10008556 [exp]	2.4	0.9607
AT4G31450			RING/U-box superfamily protein...		Lus10020145 [exp]	3.9	0.9465
AT2G20900		DGK5, ATDGK5	diacylglycerol kinase 5 (.1.2....		Lus10031612 [exp]	4.9	0.9328
AT5G41350			RING/U-box superfamily protein...		Lus10032270 [exp]	4.9	0.9462
AT2G01490			phytanoyl-CoA dioxygenase (Phy...		Lus10013462 [exp]	5.0	0.9442
AT2G32190			unknown protein		Lus10010460 [exp]	5.3	0.9290
AT3G05660		AtRLP33	receptor like protein 33 (.1)		Lus10002214 [exp]	6.9	0.9416
AT2G02800		Kin2, APK2B	protein kinase 2B (.1.2)		Lus10012850 [exp]	7.2	0.9294
AT1G06570		HPPD, HPD, PDS1	4-hydroxyphenylpyruvate dioxyg...		Lus10020740 [exp]	7.5	0.9402

Compare expression of checked genes

Lus10032673 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.