Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G19590 84 / 5e-21 ATACO1, ACO1 ACC oxidase 1 (.1) AT1G12010 54 / 3e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G05010 54 / 6e-10 ACO4, EAT1, EFE ethylene forming enzyme, ethylene-forming enzyme (.1) AT1G77330 49 / 2e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G62380 49 / 3e-08 ATACO2, ACO2 ACC oxidase 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008564 [exp] 128 / 7e-38 AT2G19590 423 / 6e-150 ACC oxidase 1 (.1) Lus10029992 [exp] 57 / 3e-11 AT1G05010 496 / 2e-178 ethylene forming enzyme, ethylene-forming enzyme (.1) Lus10035334 [exp] 56 / 8e-11 AT1G05010 495 / 6e-178 ethylene forming enzyme, ethylene-forming enzyme (.1) Lus10031530 [exp] 54 / 4e-10 AT1G05010 498 / 3e-179 ethylene forming enzyme, ethylene-forming enzyme (.1) Lus10015153 [exp] 54 / 5e-10 AT1G05010 501 / 1e-180 ethylene forming enzyme, ethylene-forming enzyme (.1) Lus10000857 [exp] 49 / 2e-08 AT1G77330 440 / 2e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10028678 [exp] 49 / 3e-08 AT1G77330 435 / 1e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G151600 [exp] 88 / 2e-22 AT2G19590 462 / 2e-165 ACC oxidase 1 (.1) Potri.004G003000 [exp] 61 / 1e-12 AT1G05010 467 / 6e-167 ethylene forming enzyme, ethylene-forming enzyme (.1) Potri.002G224100 [exp] 60 / 4e-12 AT1G05010 440 / 2e-156 ethylene forming enzyme, ethylene-forming enzyme (.1) Potri.011G020900 [exp] 58 / 1e-11 AT1G05010 473 / 1e-169 ethylene forming enzyme, ethylene-forming enzyme (.1) Potri.014G159000 [exp] 57 / 4e-11 AT1G05010 464 / 8e-166 ethylene forming enzyme, ethylene-forming enzyme (.1) Potri.002G078600 [exp] 52 / 2e-09 AT1G77330 455 / 1e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G182700 [exp] 48 / 5e-08 AT1G77330 461 / 4e-165 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150100 [exp] 40 / 3e-05 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032682 pacid=23159004 polypeptide=Lus10032682 locus=Lus10032682.g ID=Lus10032682.BGIv1.0 annot-version=v1.0 ATGGCTGACAAGGACGGGAGCAGGCTTTCGATTGCCACATTCTATAATCCAGCTCCCGATGCTGTGATTGTTTCGCCGGCGCCGGCGGGGGATTTGTCTG GGATGATGGTGTATCCGCAGGCGTATAGTTTTGGGGATTATCTTGAGCTCTATTCGGCTACTAAGTTTGCTGACAAAGGAGAGAGATTTGAGACCATGAA GAAGAAACTTACCAATCAAATCAATGGCTCTGATGTGATGTGA
AA sequence Show only first row Show all	>Lus10032682 pacid=23159004 polypeptide=Lus10032682 locus=Lus10032682.g ID=Lus10032682.BGIv1.0 annot-version=v1.0 MADKDGSRLSIATFYNPAPDAVIVSPAPAGDLSGMMVYPQAYSFGDYLELYSATKFADKGERFETMKKKLTNQINGSDVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G19590		ATACO1, ACO1	ACC oxidase 1 (.1)		Lus10032682 [exp]	0	1
AT5G44730			Haloacid dehalogenase-like hyd...		Lus10001353 [exp]	3.0	0.8635
AT1G21910	AP2_ERF	DREB26	dehydration response element-b...		Lus10003740 [exp]	4.2	0.8329
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10029580 [exp]	4.7	0.7830
AT1G03790	C3HZnF	SOM	SOMNUS, Zinc finger C-x8-C-x5-...		Lus10018621 [exp]	4.9	0.8445
AT3G10040	Trihelix		sequence-specific DNA binding ...		Lus10035582 [exp]	5.3	0.8585
AT4G10250		ATHSP22.0	HSP20-like chaperones superfam...		Lus10040560 [exp]	6.2	0.7741
AT2G30970		ASP1	aspartate aminotransferase 1 (...		Lus10025252 [exp]	9.5	0.8447
AT2G30970		ASP1	aspartate aminotransferase 1 (...		Lus10000181 [exp]	15.3	0.7559
AT3G54690		SETH3	Sugar isomerase (SIS) family p...		Lus10003549 [exp]	15.9	0.7725
AT2G19590		ATACO1, ACO1	ACC oxidase 1 (.1)		Lus10008564 [exp]	17.6	0.8344

Compare expression of checked genes

Lus10032682 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.