Lus10032687 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G41200 110 / 1e-31 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008568 230 / 9e-79 AT2G41200 138 / 3e-42 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G038600 132 / 1e-39 AT2G41200 124 / 5e-36 unknown protein
PFAM info
Representative CDS sequence
>Lus10032687 pacid=23159017 polypeptide=Lus10032687 locus=Lus10032687.g ID=Lus10032687.BGIv1.0 annot-version=v1.0
ATGGGTCAATCTTTGATGAAACTTGCTCCTGGTAAGCTGTTCTTTTCATCATCATCATCGTCTCTGCTTCAATCAATTATAACGGAAATCAACAAAAAGC
TCAACAGCACACAGTTCCGCATCCCTGACACCGAGAAGCTGAAGAAAGTCTACAAATCTCACTACAATGATGATAACAGTGAATATGAAAGGAAGAAGAA
AACATTGTCCAAAGAGGAGTTCCAAAAGGTGCTTGAAGAAATCATAATCGGAGCAGGATTCACAGGGTTTGGATCCAAGAACATCTTCCTCTACATTTTT
GGTGTCCCTGCTGCTGCTATGGTCATCAAACAAAGGATTGCTCCTACCATTATCCCCAACGATGTATTCATCCCTGCCATCACCTCCGCCACCGTCCTCA
TCCTCGCCAAACTCAACAAAATATGA
AA sequence
>Lus10032687 pacid=23159017 polypeptide=Lus10032687 locus=Lus10032687.g ID=Lus10032687.BGIv1.0 annot-version=v1.0
MGQSLMKLAPGKLFFSSSSSSLLQSIITEINKKLNSTQFRIPDTEKLKKVYKSHYNDDNSEYERKKKTLSKEEFQKVLEEIIIGAGFTGFGSKNIFLYIF
GVPAAAMVIKQRIAPTIIPNDVFIPAITSATVLILAKLNKI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G41200 unknown protein Lus10032687 0 1
AT2G41200 unknown protein Lus10008568 1.0 0.9492
AT2G34540 unknown protein Lus10028123 3.5 0.8953
AT4G37080 Protein of unknown function, D... Lus10032768 6.6 0.8564
AT5G05365 Heavy metal transport/detoxifi... Lus10009848 6.7 0.8841
AT1G29380 Carbohydrate-binding X8 domain... Lus10015259 6.9 0.9040
AT1G17050 SPS2 solanesyl diphosphate synthase... Lus10042491 6.9 0.8890
AT3G17950 unknown protein Lus10006150 8.5 0.8532
AT3G61860 ATRSP31, At-RS3... arginine/serine-rich splicing ... Lus10005986 9.2 0.8220
AT1G31170 ATSRX sulfiredoxin (.1.2.3.4) Lus10036218 12.0 0.8719
AT1G68090 ANN5, ANNAT5 ANNEXIN ARABIDOPSIS THALIANA 5... Lus10040415 12.2 0.8730

Lus10032687 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.