Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G04865 52 / 5e-09 Aminotransferase-like, plant mobile domain family protein (.1) AT2G25010 51 / 7e-09 Aminotransferase-like, plant mobile domain family protein (.1) AT1G17930 50 / 1e-08 Aminotransferase-like, plant mobile domain family protein (.1) AT1G51538 49 / 3e-08 Aminotransferase-like, plant mobile domain family protein (.1) AT1G48120 45 / 7e-07 hydrolases;protein serine/threonine phosphatases (.1) AT1G50830 45 / 9e-07 Aminotransferase-like, plant mobile domain family protein (.1) AT1G50820 45 / 1e-06 Aminotransferase-like, plant mobile domain family protein (.1) AT1G50770 44 / 2e-06 Aminotransferase-like, plant mobile domain family protein (.1) AT1G50790 43 / 5e-06 Plant mobile domain protein family (.1) AT5G18510 41 / 3e-05 Aminotransferase-like, plant mobile domain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027047 [exp] 148 / 1e-43 AT1G17930 119 / 1e-28 Aminotransferase-like, plant mobile domain family protein (.1) Lus10020970 [exp] 145 / 5e-43 AT1G17930 123 / 2e-30 Aminotransferase-like, plant mobile domain family protein (.1) Lus10003430 [exp] 118 / 7e-34 AT5G51100 60 / 6e-10 Fe superoxide dismutase 2 (.1) Lus10008761 [exp] 106 / 1e-28 AT2G25010 79 / 1e-15 Aminotransferase-like, plant mobile domain family protein (.1) Lus10004818 [exp] 102 / 1e-27 AT1G17930 56 / 2e-08 Aminotransferase-like, plant mobile domain family protein (.1) Lus10012081 [exp] 95 / 1e-25 AT1G17930 53 / 8e-08 Aminotransferase-like, plant mobile domain family protein (.1) Lus10024265 [exp] 91 / 2e-23 AT1G17930 59 / 9e-10 Aminotransferase-like, plant mobile domain family protein (.1) Lus10042711 [exp] 86 / 3e-23 AT2G25010 50 / 4e-08 Aminotransferase-like, plant mobile domain family protein (.1) Lus10003764 [exp] 61 / 2e-13 AT2G25010 53 / 2e-09 Aminotransferase-like, plant mobile domain family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10536 [flax] [poplar] PMD Plant mobile domain
Representative CDS sequence Show only first row Show all	>Lus10032693 pacid=23158949 polypeptide=Lus10032693 locus=Lus10032693.g ID=Lus10032693.BGIv1.0 annot-version=v1.0 ATGCAGGAGTCAGGACTTCTTCACTTGGGTCGGTGGCAGCCGGATACTAATGATGAGCCTCTTCTGAAGGCATTTGTTGAGAGGCGGCAGCCGGATACTA ACACCTTTCACATGCCGTGGGGAGAGATGACGATCACTTTGCACGACGTCTTCCATATTCTCCGTGTCCCGGTCACTGGACGACCACTTCATAAGCCCCG ACCTCTGGTTGACTTGAGAGCGGGTGTAGCGGAGGCGCTTTGCTTCCGCTCTGCCTTCGGCGTGGTGTGA
AA sequence Show only first row Show all	>Lus10032693 pacid=23158949 polypeptide=Lus10032693 locus=Lus10032693.g ID=Lus10032693.BGIv1.0 annot-version=v1.0 MQESGLLHLGRWQPDTNDEPLLKAFVERRQPDTNTFHMPWGEMTITLHDVFHILRVPVTGRPLHKPRPLVDLRAGVAEALCFRSAFGVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G25010			Aminotransferase-like, plant m...		Lus10032693 [exp]	0	1
AT2G46150			Late embryogenesis abundant (L...		Lus10039664 [exp]	1.0	0.9017
AT4G27570			UDP-Glycosyltransferase superf...		Lus10027483 [exp]	5.1	0.8176
					Lus10005514 [exp]	6.9	0.9011
AT5G27260			unknown protein		Lus10007175 [exp]	8.5	0.9011
AT2G36190		ATCWINV4	cell wall invertase 4 (.1)		Lus10017015 [exp]	9.8	0.9011
AT3G60730			Plant invertase/pectin methyle...		Lus10015877 [exp]	11.0	0.9011
AT1G66350	GRAS	RGL1	RGA-like 1 (.1)		Lus10016888 [exp]	12.0	0.9011
AT1G61320			FBD / Leucine Rich Repeat doma...		Lus10010664 [exp]	13.0	0.9011
AT5G05070			DHHC-type zinc finger family p...		Lus10027274 [exp]	13.9	0.9011
AT5G50850		MAB1	MACCI-BOU, Transketolase famil...		Lus10039361 [exp]	14.7	0.9011

Compare expression of checked genes

Lus10032693 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.