Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001874 [exp] 147 / 1e-45 ND / Lus10007680 [exp] 136 / 2e-42 ND / Lus10008397 [exp] 135 / 2e-42 ND / Lus10039431 [exp] 135 / 1e-41 ND / Lus10030050 [exp] 129 / 2e-40 ND 36 / 0.003 Lus10023812 [exp] 127 / 1e-37 ND / Lus10005734 [exp] 117 / 2e-33 ND / Lus10031025 [exp] 109 / 8e-32 ND / Lus10025298 [exp] 108 / 8e-32 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032696 pacid=23158971 polypeptide=Lus10032696 locus=Lus10032696.g ID=Lus10032696.BGIv1.0 annot-version=v1.0 ATGAGTTCAACCCTCACATTCGCCCGAGCGATTCCTGTTTTTATGAAGAAAATGAAGATCGCAGCAGAGGCCATCCTCCGAACCGTGTACTATCGTCATC CTATGGTGGTCGGTGATACTATTGTTGGGTATTGTCTCCGACCGTGCATCGATGAAGAGTCTTGGGGAGCTATTTACTACATGAACATGGACGAGGTCTC TCAGCCCGGCGGACAACACAACGCTGATGCTGTGGATGACGGCGAGTTTGACGACGAGCCTGTGTACGATCCAAGTAACAATAGTGGGGAAGGGGAAGAT GATCAGGCTTCGAGTTAG
AA sequence Show only first row Show all	>Lus10032696 pacid=23158971 polypeptide=Lus10032696 locus=Lus10032696.g ID=Lus10032696.BGIv1.0 annot-version=v1.0 MSSTLTFARAIPVFMKKMKIAAEAILRTVYYRHPMVVGDTIVGYCLRPCIDEESWGAIYYMNMDEVSQPGGQHNADAVDDGEFDDEPVYDPSNNSGEGED DQASS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10032696 [exp]	0	1
AT2G44450		BGLU15	beta glucosidase 15 (.1)		Lus10026057 [exp]	1.0	0.9993
					Lus10043100 [exp]	2.0	0.9949
					Lus10022993 [exp]	3.0	0.9851
					Lus10002291 [exp]	4.0	0.9708
					Lus10038642 [exp]	4.5	0.9707
AT5G08370		ATAGAL2	alpha-galactosidase 2 (.1.2)		Lus10038325 [exp]	4.7	0.9344
AT5G58980			Neutral/alkaline non-lysosomal...		Lus10021829 [exp]	7.3	0.9557
AT1G65480		FT	FLOWERING LOCUS T, PEBP (phosp...		Lus10004452 [exp]	7.3	0.9418
AT3G06530			ARM repeat superfamily protein...		Lus10026144 [exp]	7.5	0.9444
AT3G47730		ABCA2, ATATH1	A. THALIANA ABC2 HOMOLOG 1, AT...		Lus10004262 [exp]	7.7	0.9413

Compare expression of checked genes

Lus10032696 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.