Lus10032699 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G29410 162 / 4e-52 Ribosomal L28e protein family (.1.2)
AT2G19730 155 / 2e-49 Ribosomal L28e protein family (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012914 220 / 4e-75 AT4G29410 224 / 7e-77 Ribosomal L28e protein family (.1.2)
Lus10012915 218 / 3e-74 AT4G29410 224 / 1e-76 Ribosomal L28e protein family (.1.2)
Lus10006869 158 / 2e-50 AT2G19730 218 / 3e-74 Ribosomal L28e protein family (.1.2.3)
Lus10037609 156 / 8e-50 AT2G19730 221 / 2e-75 Ribosomal L28e protein family (.1.2.3)
Lus10032698 122 / 1e-35 ND 134 / 1e-40
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G045500 166 / 7e-54 AT2G19730 230 / 3e-79 Ribosomal L28e protein family (.1.2.3)
Potri.001G194000 164 / 4e-53 AT2G19730 227 / 1e-77 Ribosomal L28e protein family (.1.2.3)
Potri.006G212501 45 / 4e-07 AT4G29410 45 / 2e-07 Ribosomal L28e protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01778 Ribosomal_L28e Ribosomal L28e protein family
Representative CDS sequence
>Lus10032699 pacid=23158955 polypeptide=Lus10032699 locus=Lus10032699.g ID=Lus10032699.BGIv1.0 annot-version=v1.0
ATGGCCACAGTTCCAGGGCAGTTGATCTGGGAGGTTGTCAAGAGGAACAACTGCTTCCTCGTGAAGCAATTCGGCCGTGGCAATGCCGGTCCCCGGGTCA
GCAAGGAGAGCAACAATCTATACAACCTCAACTCCTACAAGTACTCTGGTTTGGCAAACAAGAAAACTGTTTCTATCCAGCCGGAAGGCAAGGATTTGAG
TGTTGTACTGTCTACAACCAAGACCAAGAAGCAGAACAAGCCTGCCGATTTGAAGAACAAGTCAGTGATGAGGAAGGAGTTCCACTCTATGGCTAAGGCC
GTTGCTAATCAAGTTGGAGACAACTATTACCGGGCTGATCTGAAGAAGGCAGCCCTTGCTAGACTCAGTGTTGTCCACAAGAGCCTTAAGGTTGCCAAGT
CGGGCCCCAAGAGGAGAACTAGGCAGGGGAGGAAGTGA
AA sequence
>Lus10032699 pacid=23158955 polypeptide=Lus10032699 locus=Lus10032699.g ID=Lus10032699.BGIv1.0 annot-version=v1.0
MATVPGQLIWEVVKRNNCFLVKQFGRGNAGPRVSKESNNLYNLNSYKYSGLANKKTVSIQPEGKDLSVVLSTTKTKKQNKPADLKNKSVMRKEFHSMAKA
VANQVGDNYYRADLKKAALARLSVVHKSLKVAKSGPKRRTRQGRK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G29410 Ribosomal L28e protein family ... Lus10032699 0 1
AT4G18100 Ribosomal protein L32e (.1) Lus10009591 2.2 0.9712
AT1G26880 Ribosomal protein L34e superfa... Lus10037177 2.4 0.9646
AT3G52590 HAP4, ERD16, UB... HAPLESS 4, EARLY-RESPONSIVE TO... Lus10008873 2.8 0.9703
AT5G59850 Ribosomal protein S8 family pr... Lus10029461 3.5 0.9591
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10031979 3.5 0.9627
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Lus10035650 3.9 0.9614
AT5G59850 Ribosomal protein S8 family pr... Lus10005960 4.2 0.9537
AT1G09810 ECT11 evolutionarily conserved C-ter... Lus10035790 9.2 0.9466
AT1G22780 RPS18A, PFL1, P... 40S RIBOSOMAL PROTEIN S18, POI... Lus10042603 9.4 0.9534
AT5G27700 Ribosomal protein S21e (.1) Lus10015173 9.4 0.9545

Lus10032699 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.