Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80950 123 / 5e-35 Phospholipid/glycerol acyltransferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003950 [exp] 168 / 3e-52 AT1G80950 492 / 4e-174 Phospholipid/glycerol acyltransferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G042200 [exp] 141 / 8e-42 AT1G80950 506 / 7e-180 Phospholipid/glycerol acyltransferase family protein (.1) Potri.002G134100 [exp] 113 / 4e-31 AT1G80950 476 / 1e-167 Phospholipid/glycerol acyltransferase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032707 pacid=23158966 polypeptide=Lus10032707 locus=Lus10032707.g ID=Lus10032707.BGIv1.0 annot-version=v1.0 ATGGTGTTGTATTCGCTAATAGTTCTGAGATGTTTCCATTTCCAGCTGCGCCATGTAATTCTTCTCTTCTGTCAATTCGTAAATCACCTGGAGGTGATAA GGCTACCTGTTTACTACCCTTGCCAAGAAGAGAAAGATAACCCTAAACTATATGCTAATAATATTCGACGGTTGATGGCGCGCGAGGGTAATCTAGTAAT GTCAGAGATCGGACTAGCCGAGAAGAGAGTATACATTGCTGCACTCAACGGTAATAATAGCCTGCCTAGTGTTTTGCATCAGAAAGACGATTGA
AA sequence Show only first row Show all	>Lus10032707 pacid=23158966 polypeptide=Lus10032707 locus=Lus10032707.g ID=Lus10032707.BGIv1.0 annot-version=v1.0 MVLYSLIVLRCFHFQLRHVILLFCQFVNHLEVIRLPVYYPCQEEKDNPKLYANNIRRLMAREGNLVMSEIGLAEKRVYIAALNGNNSLPSVLHQKDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G80950			Phospholipid/glycerol acyltran...		Lus10032707 [exp]	0	1
AT5G24080			Protein kinase superfamily pro...		Lus10039315 [exp]	4.2	0.8909
AT5G62270			unknown protein		Lus10035022 [exp]	13.0	0.8861
AT4G39330		AtCAD1, ATCAD9	cinnamyl alcohol dehydrogenase...		Lus10017285 [exp]	14.1	0.9006
AT1G77380		AAP3, ATAAP3	amino acid permease 3 (.1)		Lus10036777 [exp]	20.8	0.8701
AT2G45430	AT-hook	AHL22	AT-hook motif nuclear-localize...		Lus10007007 [exp]	22.5	0.8928
AT3G58180			ARM repeat superfamily protein...		Lus10007032 [exp]	22.6	0.8803
AT5G46840			RNA-binding (RRM/RBD/RNP motif...		Lus10000904 [exp]	27.5	0.8810
AT5G56040			Leucine-rich receptor-like pro...		Lus10032954 [exp]	28.2	0.8830
AT3G04580		EIN4	ETHYLENE INSENSITIVE 4, Signal...		Lus10006574 [exp]	32.5	0.8451
AT1G51190	AP2_ERF	PLT2	PLETHORA 2, Integrase-type DNA...		Lus10031260 [exp]	38.6	0.8751

Compare expression of checked genes

Lus10032707 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.