Lus10032708 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47740 357 / 1e-125 PPPDE putative thiol peptidase family protein (.1.2)
AT4G17486 226 / 1e-74 PPPDE putative thiol peptidase family protein (.1.2)
AT5G25170 225 / 2e-74 PPPDE putative thiol peptidase family protein (.1)
AT5G47310 225 / 4e-74 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 221 / 2e-72 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 220 / 5e-72 PPPDE putative thiol peptidase family protein (.1)
AT4G31980 203 / 5e-61 unknown protein
AT4G25680 77 / 8e-17 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 76 / 2e-16 PPPDE putative thiol peptidase family protein (.1)
AT3G07090 58 / 8e-10 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003951 490 / 2e-178 AT1G47740 358 / 8e-126 PPPDE putative thiol peptidase family protein (.1.2)
Lus10040485 280 / 2e-95 AT1G47740 272 / 6e-92 PPPDE putative thiol peptidase family protein (.1.2)
Lus10011291 275 / 2e-93 AT1G47740 270 / 3e-91 PPPDE putative thiol peptidase family protein (.1.2)
Lus10018326 233 / 1e-77 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10005341 230 / 2e-76 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1)
Lus10017127 229 / 6e-76 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10041021 225 / 2e-74 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1)
Lus10040170 222 / 3e-73 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Lus10039492 216 / 3e-71 AT1G47740 213 / 2e-69 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G134200 397 / 6e-142 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.014G042300 394 / 1e-140 AT1G47740 339 / 2e-118 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 344 / 8e-121 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.009G113168 343 / 3e-120 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.004G151200 334 / 5e-117 AT1G47740 335 / 1e-116 PPPDE putative thiol peptidase family protein (.1.2)
Potri.003G080300 235 / 5e-78 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.018G021700 230 / 4e-76 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.006G261500 230 / 6e-76 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.001G154400 229 / 7e-76 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.003G180400 220 / 3e-72 AT1G80690 303 / 1e-105 PPPDE putative thiol peptidase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10032708 pacid=23158964 polypeptide=Lus10032708 locus=Lus10032708.g ID=Lus10032708.BGIv1.0 annot-version=v1.0
ATGAAACTGGAGTCGAAGAAAGGATGGAAAGCAATGATGCCCCTTAGGCTGAGGAGTAAAACGGGCACAGGTACACGTTTTTGTTTGTTCCCAAAACAAA
GGACAGTTGGGTATGGTCCAGACAAAGCACCAGTCTATCTCAATGTCTATGACTTGACACCCATGAATGGCTATGTCTATTGGGCTGGTCTTGGCATCTT
TCACTCCGGTGTCCAAGTTCATGGGGTAGAGTATGCATTCGGAGCGCATGACTACCCGACGAGTGGGGTATTCGAGGTTGAGCCAAGGCAGTGTCCTGGC
TTTAAGTTCAGAAGGTCTATATTTGTAGGAACCACGTCCATGGATCCCAATCAGGTTAGGGAGTTTATGGAGCAGCACGCAGCGAGCTACCATGGCGATA
CCTACCACTTAATTGTTAAGAATTGCAATCATTTTTGCACGGATGTTTGTCGCAAGATCACGGGTAGACCGATTCCAAAATGGGTTAATCGACTTGCACA
AATAGGATCAGTATGCAACTGCATACTTCCAGAGTCTCTCAAGATAACAGCGGATCCAAATGGAGAAGCATACGACAGTGAAAAGACAAGGCTGAGAAGT
GCATTCAGTTGCTTGTCTTCAATCTCAATGAGACAGAAGCAGCTATCGACGTCCTCATTAATCCTACAGTCGCCACTGAGAGGTTGCCTACCGTGGGAAT
TCAAGAGGTCAATCAGCAGTTCGCTCAAGGAGAGATGA
AA sequence
>Lus10032708 pacid=23158964 polypeptide=Lus10032708 locus=Lus10032708.g ID=Lus10032708.BGIv1.0 annot-version=v1.0
MKLESKKGWKAMMPLRLRSKTGTGTRFCLFPKQRTVGYGPDKAPVYLNVYDLTPMNGYVYWAGLGIFHSGVQVHGVEYAFGAHDYPTSGVFEVEPRQCPG
FKFRRSIFVGTTSMDPNQVREFMEQHAASYHGDTYHLIVKNCNHFCTDVCRKITGRPIPKWVNRLAQIGSVCNCILPESLKITADPNGEAYDSEKTRLRS
AFSCLSSISMRQKQLSTSSLILQSPLRGCLPWEFKRSISSSLKER

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47740 PPPDE putative thiol peptidase... Lus10032708 0 1
AT1G47740 PPPDE putative thiol peptidase... Lus10003951 2.0 0.8759
AT5G13120 Pnsl5, ATCYP20-... Photosynthetic NDH subcomplex... Lus10011330 6.3 0.8451
AT1G03150 Acyl-CoA N-acyltransferases (N... Lus10042595 6.5 0.8208
AT1G09795 HISN1B, ATATP-P... ATP phosphoribosyl transferase... Lus10028993 7.5 0.8435
AT4G37630 CYCD5;1 cyclin d5;1 (.1.2) Lus10018688 8.9 0.8274
AT2G24800 Peroxidase superfamily protein... Lus10026903 11.8 0.8407
AT1G12410 EMB3146, CLP2, ... NUCLEAR-ENCODED CLP PROTEASE P... Lus10028905 12.2 0.8222
AT1G73940 unknown protein Lus10010150 12.5 0.8056
Lus10018607 16.6 0.7743
AT4G02980 ABP1 endoplasmic reticulum auxin bi... Lus10027985 17.4 0.8014

Lus10032708 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.