Gene [FLAX] | FIBexDB

Lus10032716 [FLAX]

External link

Symbol

Arabidopsis homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	TF class	Alias	TAIR10 short description
AT4G33355	42 / 1e-06			Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT3G51590	35 / 0.0006		LTP12	lipid transfer protein 12 (.1)

Paralogs

Show only best Show top 10

Gene ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Lus10042512 [exp]	94 / 4e-27	AT2G18370	64 / 2e-14	Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10039270 [exp]	91 / 1e-25	AT5G59310	69 / 4e-16	lipid transfer protein 4 (.1)
Lus10031282 [exp]	89 / 3e-25	AT4G33355	56 / 1e-11	Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10031851 [exp]	86 / 1e-22	AT5G58510	109 / 2e-27	unknown protein
Lus10009630 [exp]	45 / 2e-07	AT3G51590	59 / 5e-12	lipid transfer protein 12 (.1)
Lus10040917 [exp]	42 / 2e-06	AT4G01030	898 / 0.0	pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10009003 [exp]	42 / 2e-06	AT3G51590	59 / 5e-12	lipid transfer protein 12 (.1)
Lus10029445 [exp]	41 / 3e-06	AT4G33355	103 / 2e-29	Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10025234 [exp]	37 / 8e-05	AT2G38530	118 / 2e-35	cell growth defect factor-3, lipid transfer protein 2 (.1)

Poplar homologues

Show only best Show top 10

Locus ID	BLAST score/e-value	At best hit	BLAST score/e-value	TAIR10 short description
Potri.016G135700 [exp]	39 / 1e-05	AT5G59310	92 / 3e-25	lipid transfer protein 4 (.1)
Potri.011G165750 [exp]	38 / 1e-05	ND	/
Potri.001G232700 [exp]	39 / 2e-05	AT2G18370	93 / 1e-25	Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.016G135500 [exp]	39 / 2e-05	AT5G59320	94 / 8e-26	lipid transfer protein 3 (.1)
Potri.009G025200 [exp]	39 / 2e-05	AT2G18370	86 / 6e-23	Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G232900 [exp]	38 / 3e-05	AT2G18370	100 / 3e-28	Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.011G021900 [exp]	38 / 5e-05	AT3G08770	60 / 8e-13	lipid transfer protein 6 (.1.2)

PFAM info

Representative CDS sequence

Show only first row Show all

>Lus10032716 pacid=23158968 polypeptide=Lus10032716 locus=Lus10032716.g ID=Lus10032716.BGIv1.0 annot-version=v1.0

ATGGACGACAAGAAGATAGCTTGCAATTGTCTTGTCACTGCTTTCAAGATCTTTCCGGTACAAGATGATTTACTGAAAAAGATTCCAGACTTATGCAAAC

TTAAAGTTCCTTTCAACATGTCAACCACAGTTGACTGTGACAATATCAATAATTTCGCTACCGGATGGTAG

AA sequence

Show only first row Show all

>Lus10032716 pacid=23158968 polypeptide=Lus10032716 locus=Lus10032716.g ID=Lus10032716.BGIv1.0 annot-version=v1.0

MDDKKIACNCLVTAFKIFPVQDDLLKKIPDLCKLKVPFNMSTTVDCDNINNFATGW

DESeq2's median of ratios [FLAX]

Coexpressed genes

Download tab-delimited text

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33355			Bifunctional inhibitor/lipid-t...		Lus10032716 [exp]	0	1

Lus10032716 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.