Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007779 [exp] 45 / 1e-06 ND / Lus10027613 [exp] 44 / 2e-06 ND / Lus10039353 [exp] 44 / 3e-06 ND / Lus10017800 [exp] 40 / 4e-05 ND / Lus10042979 [exp] 38 / 0.0004 AT5G08020 54 / 5e-07 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032731 pacid=23158943 polypeptide=Lus10032731 locus=Lus10032731.g ID=Lus10032731.BGIv1.0 annot-version=v1.0 ATGTCGAAAGTGCTTACAGCTCCTGTGTTAGGTAGGAGTTTTACTGCAACACGCATTTCTGTCAATCCACATGTGCCTGAAACGAAACTGCTACAGAACA CTCCTCCGCATGAAGTTGTCCTCCTCAATGACGCTACACAGGATGCACGCATGCTCGCACTTCACTGGCGACTGTTTCTTGCTGAAATCCGATCGTTAGG CCCCTCGCCAACAGGCTTAGCCAAATCAAATTTGAAGCCACTTCCTATCTGGAACCCCGTGGCTGCGTTCTTCTGA
AA sequence Show only first row Show all	>Lus10032731 pacid=23158943 polypeptide=Lus10032731 locus=Lus10032731.g ID=Lus10032731.BGIv1.0 annot-version=v1.0 MSKVLTAPVLGRSFTATRISVNPHVPETKLLQNTPPHEVVLLNDATQDARMLALHWRLFLAEIRSLGPSPTGLAKSNLKPLPIWNPVAAFF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10032731 [exp]	0	1
AT5G45140		NRPC2	nuclear RNA polymerase C2 (.1)		Lus10011322 [exp]	11.3	0.7004
AT5G03810			GDSL-like Lipase/Acylhydrolase...		Lus10040791 [exp]	15.8	0.7088
AT4G05530		SDRA, IBR1	SHORT-CHAIN DEHYDROGENASE/REDU...		Lus10001430 [exp]	21.3	0.6868
AT3G14610		CYP72A7	"cytochrome P450, family 72, s...		Lus10025006 [exp]	27.2	0.6981
AT4G25420		AT2301, GA5, AT...	GA REQUIRING 5, ARABIDOPSIS TH...		Lus10015016 [exp]	33.2	0.6718
AT1G02400		ATGA2OX4, ATGA2...	DOWNSTREAM TARGET OF AGL15 1, ...		Lus10025016 [exp]	33.5	0.6821
					Lus10020856 [exp]	48.1	0.5811
AT5G66310			ATP binding microtubule motor ...		Lus10014268 [exp]	51.6	0.6608
					Lus10002304 [exp]	53.0	0.6495
AT2G37370			unknown protein		Lus10009063 [exp]	58.0	0.6282

Compare expression of checked genes

Lus10032731 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.