Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011653 [exp] 179 / 4e-60 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G038500 [exp] 74 / 3e-18 ND / Potri.002G130500 [exp] 73 / 5e-18 AT5G66985 / unknown protein Potri.007G034700 [exp] 58 / 2e-12 AT5G66985 43 / 1e-06 unknown protein Potri.005G131000 [exp] 54 / 2e-10 AT5G66985 43 / 2e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032742 pacid=23158982 polypeptide=Lus10032742 locus=Lus10032742.g ID=Lus10032742.BGIv1.0 annot-version=v1.0 ATGTCTTCTACGGTGGCCAAAAACCAGCAAACCACTCGCTCGGCGGAGAGTATTCCGGACGAACAGGAAGAAGTAGGGGAAGACGTTATGCCTAGCGCCG TCAGCAGCCAGGTGTACCTGAAGCCCGGAACCCTGGACAGAGAGGTGGTGCTGAAGAGGATCCGGCAGCGGAAGCGGATGAACAAGGTTACCGGAGCGAT CCAAGGTCTGTTCGGGTTCCAAGCCGCTGAGAAATCCAACGTCGTTAAACCCGACGACGGAAAATCCGTTTCCGTTAAGTGGGTGGATGATGCCTTTGCT GCCCCCTAA
AA sequence Show only first row Show all	>Lus10032742 pacid=23158982 polypeptide=Lus10032742 locus=Lus10032742.g ID=Lus10032742.BGIv1.0 annot-version=v1.0 MSSTVAKNQQTTRSAESIPDEQEEVGEDVMPSAVSSQVYLKPGTLDREVVLKRIRQRKRMNKVTGAIQGLFGFQAAEKSNVVKPDDGKSVSVKWVDDAFA AP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10032742 [exp]	0	1
					Lus10011653 [exp]	1.0	0.9893
AT4G08320		TPR8	tetratricopeptide repeat 8, Te...		Lus10025656 [exp]	3.7	0.9625
AT3G14880			unknown protein		Lus10042453 [exp]	4.0	0.9683
AT3G50845			Protein of unknown function (D...		Lus10026019 [exp]	4.9	0.9628
AT1G11340			S-locus lectin protein kinase ...		Lus10041679 [exp]	7.7	0.9492
AT1G72360	AP2_ERF	AtERF73, HRE1	HYPOXIA RESPONSIVE ERF \(ETHYL...		Lus10008214 [exp]	11.0	0.9647
AT1G79460		ATKS1, ATKS, GA...	GA REQUIRING 2, ARABIDOPSIS TH...		Lus10014673 [exp]	11.2	0.9634
AT1G76360			Protein kinase superfamily pro...		Lus10012256 [exp]	11.9	0.9442
AT5G54960		PDC2	pyruvate decarboxylase-2 (.1)		Lus10005048 [exp]	12.3	0.9621
AT2G38310		RCAR10, PYL4	regulatory components of ABA r...		Lus10007530 [exp]	13.4	0.9451

Compare expression of checked genes

Lus10032742 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.