Lus10032749 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33280 59 / 1e-11 B3 REM16 AP2/B3-like transcriptional factor family protein (.1)
AT4G34400 53 / 3e-09 B3 AP2/B3-like transcriptional factor family protein (.1)
AT3G18960 39 / 0.0002 B3 AP2/B3-like transcriptional factor family protein (.1)
AT5G66980 39 / 0.0002 B3 AP2/B3-like transcriptional factor family protein (.1)
AT4G31610 39 / 0.0003 B3 REM1, ATREM1 REPRODUCTIVE MERISTEM 1, Transcriptional factor B3 family protein (.1)
AT4G01580 38 / 0.0004 B3 AP2/B3-like transcriptional factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016286 81 / 2e-19 AT4G33280 166 / 7e-49 AP2/B3-like transcriptional factor family protein (.1)
Lus10016285 80 / 9e-19 AT4G33280 139 / 3e-37 AP2/B3-like transcriptional factor family protein (.1)
Lus10023691 76 / 2e-17 AT4G33280 192 / 4e-57 AP2/B3-like transcriptional factor family protein (.1)
Lus10032873 76 / 3e-17 AT4G33280 129 / 1e-33 AP2/B3-like transcriptional factor family protein (.1)
Lus10032871 62 / 2e-12 AT4G33280 152 / 1e-42 AP2/B3-like transcriptional factor family protein (.1)
Lus10032872 57 / 9e-11 AT4G33280 93 / 2e-28 AP2/B3-like transcriptional factor family protein (.1)
Lus10027943 48 / 2e-07 AT3G18960 76 / 9e-16 AP2/B3-like transcriptional factor family protein (.1)
Lus10017970 42 / 2e-05 AT3G18990 90 / 1e-20 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
Lus10041961 42 / 2e-05 AT3G18990 94 / 3e-22 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G129800 71 / 8e-16 AT4G33280 159 / 9e-45 AP2/B3-like transcriptional factor family protein (.1)
Potri.014G036900 61 / 2e-12 AT4G33280 256 / 5e-83 AP2/B3-like transcriptional factor family protein (.1)
Potri.002G129900 59 / 3e-11 AT4G33280 237 / 9e-76 AP2/B3-like transcriptional factor family protein (.1)
Potri.014G036800 53 / 3e-09 AT3G18990 92 / 3e-20 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
Potri.010G191500 45 / 1e-06 AT3G18990 189 / 5e-57 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0405 DNA_b-psBarrel PF02362 B3 B3 DNA binding domain
Representative CDS sequence
>Lus10032749 pacid=23158960 polypeptide=Lus10032749 locus=Lus10032749.g ID=Lus10032749.BGIv1.0 annot-version=v1.0
ATGAGACACAAATTGCCGGAAACCGTCACGGTAAGGGGTCCCAGCAAAATTGAGTGGAGAGCTGGATCGACGGCCGAAAATGACAGCGGCGTGTTCTTCT
CTCTCAGCTGGAGGGAATTCGCAGCGAACAACTCATTGCAACCCAATGATCTGTTAGTCTTCAAGTACAGTGATGATTCCGGTTTCGATGTTGGGATTGT
CGATCCCGCCATCTCCTGCGAGACGTTGCACTGGATTTCGCCAGGAAAATTGAGGCACCTAAACGGGGTCGTCAGACTCAGCCAGCTGCAGAGGAGGAAG
AAGTGA
AA sequence
>Lus10032749 pacid=23158960 polypeptide=Lus10032749 locus=Lus10032749.g ID=Lus10032749.BGIv1.0 annot-version=v1.0
MRHKLPETVTVRGPSKIEWRAGSTAENDSGVFFSLSWREFAANNSLQPNDLLVFKYSDDSGFDVGIVDPAISCETLHWISPGKLRHLNGVVRLSQLQRRK
K

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G33280 B3 REM16 AP2/B3-like transcriptional fa... Lus10032749 0 1
AT3G53200 MYB ATMYB27 myb domain protein 27 (.1) Lus10014415 8.4 0.9280
Lus10025421 18.5 0.9188
AT1G11260 ATSTP1, STP1 sugar transporter 1 (.1) Lus10042516 24.2 0.9259
AT5G65030 unknown protein Lus10026049 26.8 0.9234
AT1G14160 Uncharacterised protein family... Lus10037160 27.5 0.9242
AT2G02850 ARPN plantacyanin (.1) Lus10022800 28.6 0.9216
Lus10041676 29.6 0.9195
AT4G18220 Drug/metabolite transporter su... Lus10043396 30.6 0.9140
AT3G10915 Reticulon family protein (.1.2... Lus10029041 41.6 0.9154
AT2G23450 Protein kinase superfamily pro... Lus10011652 45.8 0.9193

Lus10032749 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.