Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63380 131 / 3e-37 AMP-dependent synthetase and ligase family protein (.1) AT1G20500 84 / 2e-20 AMP-dependent synthetase and ligase family protein (.1) AT1G20490 83 / 4e-20 AMP-dependent synthetase and ligase family protein (.1) AT1G20510 78 / 3e-18 OPCL1 OPC-8:0 CoA ligase1 (.1.2) AT1G20480 78 / 4e-18 AMP-dependent synthetase and ligase family protein (.1) AT5G38120 76 / 2e-17 4CL8 AMP-dependent synthetase and ligase family protein (.1) AT1G51680 71 / 1e-15 AT4CL1, 4CL.1, 4CL1 ARABIDOPSIS THALIANA 4-COUMARATE:COA LIGASE 1, 4-coumarate:CoA ligase 1 (.1.2.3) AT4G05160 70 / 3e-15 AMP-dependent synthetase and ligase family protein (.1) AT3G21240 66 / 6e-14 AT4CL2, 4CL2 4-coumarate:CoA ligase 2 (.1) AT1G65060 62 / 1e-12 4CL3 4-coumarate:CoA ligase 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002791 [exp] 175 / 2e-53 AT5G63380 688 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Lus10016135 [exp] 80 / 5e-19 AT4G05160 791 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Lus10021431 [exp] 80 / 7e-19 AT4G05160 803 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Lus10036994 [exp] 78 / 3e-18 AT5G63380 516 / 4e-179 AMP-dependent synthetase and ligase family protein (.1) Lus10015999 [exp] 76 / 2e-17 AT1G20510 692 / 0.0 OPC-8:0 CoA ligase1 (.1.2) Lus10005390 [exp] 76 / 3e-17 AT1G51680 827 / 0.0 ARABIDOPSIS THALIANA 4-COUMARATE:COA LIGASE 1, 4-coumarate:CoA ligase 1 (.1.2.3) Lus10024123 [exp] 76 / 3e-17 AT3G21240 835 / 0.0 4-coumarate:CoA ligase 2 (.1) Lus10038667 [exp] 73 / 3e-16 AT1G20510 449 / 1e-152 OPC-8:0 CoA ligase1 (.1.2) Lus10012280 [exp] 72 / 4e-16 AT1G20510 825 / 0.0 OPC-8:0 CoA ligase1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G094800 [exp] 130 / 4e-37 AT5G63380 657 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.015G092300 [exp] 121 / 7e-34 AT5G63380 594 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.017G033600 [exp] 110 / 1e-29 AT5G63380 598 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.012G095000 [exp] 109 / 2e-29 AT5G63380 615 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.012G094900 [exp] 107 / 1e-28 AT5G63380 604 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.010G230200 [exp] 82 / 1e-19 AT1G20510 478 / 7e-164 OPC-8:0 CoA ligase1 (.1.2) Potri.008G031500 [exp] 80 / 5e-19 AT1G20510 466 / 3e-159 OPC-8:0 CoA ligase1 (.1.2) Potri.002G012800 [exp] 79 / 2e-18 AT1G20510 769 / 0.0 OPC-8:0 CoA ligase1 (.1.2) Potri.017G112800 [exp] 78 / 2e-18 AT4G05160 852 / 0.0 AMP-dependent synthetase and ligase family protein (.1) Potri.001G036900 [exp] 72 / 3e-16 AT3G21240 768 / 0.0 4-coumarate:CoA ligase 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0378 [flax] [poplar] ANL PF00501 [flax] [poplar] AMP-binding AMP-binding enzyme
Representative CDS sequence Show only first row Show all	>Lus10032755 pacid=23159034 polypeptide=Lus10032755 locus=Lus10032755.g ID=Lus10032755.BGIv1.0 annot-version=v1.0 ATGTTGGTGAAAGGGATTGCCATAGGAGAGACTCTGGTTCTGATGCAGAGGTTCGATTTCGAAGGGATGCTTCGGGCTGTGGAGAAGTACAAGGTGACTT ACATGCCGGTATCTCCGCCGCTCATCGTGGGAATGCTCAAGTCGGAGCTGACCAATAAGTATGATTTGAGCTCCCTCTTAGTTTTGGGCTGCGGTGGGGC TCCACTCGGCAAGCGTGTTGCCGAAAAGTTCAAGGACAAATTCCCAAATGTGGATATCATCCCGGTATTTTCATTTCTTGTTAATTAA
AA sequence Show only first row Show all	>Lus10032755 pacid=23159034 polypeptide=Lus10032755 locus=Lus10032755.g ID=Lus10032755.BGIv1.0 annot-version=v1.0 MLVKGIAIGETLVLMQRFDFEGMLRAVEKYKVTYMPVSPPLIVGMLKSELTNKYDLSSLLVLGCGGAPLGKRVAEKFKDKFPNVDIIPVFSFLVN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G63380			AMP-dependent synthetase and l...		Lus10032755 [exp]	0	1
AT3G07720			Galactose oxidase/kelch repeat...		Lus10012345 [exp]	10.2	0.8063
AT1G18590		SOT17, ATSOT17,...	ARABIDOPSIS SULFOTRANSFERASE 5...		Lus10017878 [exp]	10.3	0.8148
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Lus10010880 [exp]	14.7	0.8048
AT4G16490			ARM repeat superfamily protein...		Lus10039047 [exp]	16.1	0.8067
AT1G17890		GER2	NAD(P)-binding Rossmann-fold s...		Lus10037102 [exp]	16.5	0.7886
AT3G47520		pNAD-MDH, MDH	plastidic NAD-dependent malate...		Lus10000275 [exp]	16.8	0.8033
AT5G47120		ATBI-1, ATBI1	ARABIDOPSIS BAX INHIBITOR 1, B...		Lus10000589 [exp]	19.5	0.8075
AT2G32300		UCC1	uclacyanin 1 (.1)		Lus10003799 [exp]	22.2	0.7889
AT4G29120			6-phosphogluconate dehydrogena...		Lus10012950 [exp]	25.4	0.8032
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Lus10040745 [exp]	26.3	0.7953

Compare expression of checked genes

Lus10032755 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.