Lus10032763 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G06430 120 / 3e-35 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021764 225 / 1e-76 AT5G06430 255 / 2e-87 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G035300 127 / 6e-38 AT5G06430 251 / 1e-85 Thioredoxin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10032763 pacid=23159031 polypeptide=Lus10032763 locus=Lus10032763.g ID=Lus10032763.BGIv1.0 annot-version=v1.0
ATGAAAACCGACGCAGCTCCTCCAAAGCATCCTCTCTTCTGTCTAACATGGCCTTGGGACCAGAATCACAAAACTAGCCCCAACGCCTGCTCTTACGAGG
GTCCATGGCTGCTGAAATCCCTCAGCACTCTGGACTCCATTGCCCTAAAATCCATAAACTCGGTCTCCAATTCGTCGGCGAATGGGAAAGGAAAGAGAAG
TGCGGAAGAGCAGGCTGAGGCGGAGCAAAGAGCGTTTGCTTCGGCTCTGGCTGGCGGGAAAGAGGCAACGGTGCTTGAATTTTACTCCCCCAAGTGTATG
CTCTGCAACTCATTGGTCAATTTGGTGACGGAGGTGGAGAGGAGAAACTGGGATTGGGTCAACATTGTGATGGCCGATGCAAAGAATGAACAATGGCTGC
CTGAGATAAAGTAA
AA sequence
>Lus10032763 pacid=23159031 polypeptide=Lus10032763 locus=Lus10032763.g ID=Lus10032763.BGIv1.0 annot-version=v1.0
MKTDAAPPKHPLFCLTWPWDQNHKTSPNACSYEGPWLLKSLSTLDSIALKSINSVSNSSANGKGKRSAEEQAEAEQRAFASALAGGKEATVLEFYSPKCM
LCNSLVNLVTEVERRNWDWVNIVMADAKNEQWLPEIK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G06430 Thioredoxin superfamily protei... Lus10032763 0 1
AT1G20650 ASG5 ALTERED SEED GERMINATION 5, Pr... Lus10013222 1.7 0.8109
AT5G07610 F-box family protein (.1) Lus10015048 6.3 0.7711
AT3G24000 Tetratricopeptide repeat (TPR)... Lus10002561 17.3 0.7390
AT3G56330 N2,N2-dimethylguanosine tRNA m... Lus10029044 63.3 0.7526
AT2G32720 B5 #4, B5#4, AT... ARABIDOPSIS CYTOCHROME B5 ISOF... Lus10012615 73.1 0.7346
AT1G64810 APO1 ACCUMULATION OF PHOTOSYSTEM ON... Lus10039122 76.7 0.7274
AT2G38420 Pentatricopeptide repeat (PPR)... Lus10002476 99.5 0.7249
AT2G32230 PRORP1 proteinaceous RNase P 1 (.1) Lus10043223 100.4 0.6918
Lus10039851 117.7 0.6908
Lus10029579 130.2 0.7061

Lus10032763 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.