Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025405 [exp] 38 / 6e-05 ND 40 / 1e-05 Lus10025403 [exp] 38 / 0.0003 AT4G18630 167 / 9e-45 Protein of unknown function (DUF688) (.1) Lus10015280 [exp] 37 / 0.0008 AT5G45850 170 / 2e-45 Protein of unknown function (DUF688) (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05097 [flax] [poplar] DUF688 Protein of unknown function (DUF688)
Representative CDS sequence Show only first row Show all	>Lus10032767 pacid=23158983 polypeptide=Lus10032767 locus=Lus10032767.g ID=Lus10032767.BGIv1.0 annot-version=v1.0 ATGATGAGTCGGTTCGTGCCTGCTGCAAAGGCAATGACTTTGGATCACCAGCCTCAGTACTCTTCAAAGAAGCAGCAGCAGCAACAATCGAGACGATTGT TGTTGTTAGCTGACGCTAGTCGCCAGCTGCTATTGTTTCATACTGCCATCCCAAGGAAGAGAGTGAAGAAGAAGACTGATGATGATAATGAATATGAATA TGATGAGTCTGTGAGTTTGCCAATGGAAATGATGTTTGTGGAGAATTATCCAAAGCCTTGGTATGTGTAA
AA sequence Show only first row Show all	>Lus10032767 pacid=23158983 polypeptide=Lus10032767 locus=Lus10032767.g ID=Lus10032767.BGIv1.0 annot-version=v1.0 MMSRFVPAAKAMTLDHQPQYSSKKQQQQQSRRLLLLADASRQLLLFHTAIPRKRVKKKTDDDNEYEYDESVSLPMEMMFVENYPKPWYV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10032767 [exp]	0	1
					Lus10035062 [exp]	1.7	0.9799
					Lus10035048 [exp]	4.0	0.9682
					Lus10002859 [exp]	4.6	0.9656
AT1G11570		NTL	NTF2-like (.1.2)		Lus10006762 [exp]	5.0	0.9202
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Lus10033212 [exp]	7.4	0.9535
AT3G04030	GARP		Homeodomain-like superfamily p...		Lus10020264 [exp]	8.0	0.9560
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Lus10028306 [exp]	12.0	0.9373
					Lus10019472 [exp]	13.0	0.9394
AT2G14560		LURP1	LATE UPREGULATED IN RESPONSE T...		Lus10009095 [exp]	13.0	0.8622
AT1G23850			unknown protein		Lus10032153 [exp]	13.5	0.9246

Compare expression of checked genes

Lus10032767 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.