Lus10032770 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029617 244 / 1e-84 ND /
Lus10032788 242 / 9e-84 ND 36 / 0.007
Lus10042684 199 / 9e-67 ND /
Lus10029619 198 / 2e-66 ND /
Lus10003755 127 / 2e-38 ND 37 / 0.002
Lus10003753 126 / 5e-38 ND /
Lus10003754 120 / 8e-36 AT1G04520 39 / 3e-04 plasmodesmata-located protein 2 (.1)
Lus10008314 119 / 5e-35 ND /
Lus10029618 118 / 1e-34 ND /
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10032770 pacid=23158999 polypeptide=Lus10032770 locus=Lus10032770.g ID=Lus10032770.BGIv1.0 annot-version=v1.0
ATGGTTTATGTGTCGAAATTGGCTGCAGCGATCACATTTCTGATCCTGGCTATTTTGAGCGTGGTCGTTGTCGAGGGTGCAGACAAGAGCGTCATCAGCG
GACCATACTGCATCAAGAAATCCTTGGACAGGGATTACAACAGGAATGCAAAACGTCTCATGGATATCCTTGTGGACGAAACCCGAGACAAGTATAGGAT
GAGGGATCATGAGGAATACAGGTACTATCATAGCTACCCAAATAAGGACTTGGGTTCCGTCCTTGGTGGTGGGTATTGCGATGGACACCTCTCGAAATGG
GGATGTGGCAGTTGCCTTGACTCTGCGAGGGGAAAAATCAAATTCCGTTGCGATCATACATTTGAGGCTAGTATTCAACTTACAGATTGTTCCCTTTGGT
TCAGGAAGATCGTTAATCACCAAAACGAAACTGAGTACTAG
AA sequence
>Lus10032770 pacid=23158999 polypeptide=Lus10032770 locus=Lus10032770.g ID=Lus10032770.BGIv1.0 annot-version=v1.0
MVYVSKLAAAITFLILAILSVVVVEGADKSVISGPYCIKKSLDRDYNRNAKRLMDILVDETRDKYRMRDHEEYRYYHSYPNKDLGSVLGGGYCDGHLSKW
GCGSCLDSARGKIKFRCDHTFEASIQLTDCSLWFRKIVNHQNETEY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10032770 0 1
Lus10037041 12.1 0.9319
AT5G16023 RTFL18, DVL1 DEVIL 1, ROTUNDIFOLIA like 18 ... Lus10003079 12.5 0.9600
AT1G65090 unknown protein Lus10020377 18.8 0.9529
AT1G05510 Protein of unknown function (D... Lus10021483 22.1 0.8693
AT4G15480 UGT84A1 UDP-Glycosyltransferase superf... Lus10027862 24.0 0.9514
AT2G42760 unknown protein Lus10015227 24.3 0.8376
Lus10019223 27.5 0.9496
AT5G16023 RTFL18, DVL1 DEVIL 1, ROTUNDIFOLIA like 18 ... Lus10034071 30.8 0.9480
AT1G50310 ATSTP9 sugar transporter 9 (.1) Lus10013441 34.0 0.9478
Lus10010593 37.2 0.9478

Lus10032770 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.