Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10865 105 / 6e-32 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029612 [exp] 124 / 1e-34 AT3G04470 857 / 0.0 Ankyrin repeat family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G010300 [exp] 110 / 1e-33 AT1G10865 124 / 2e-39 unknown protein Potri.010G248800 [exp] 103 / 5e-31 AT1G10865 120 / 1e-37 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10203 [flax] [poplar] Pet191_N Cytochrome c oxidase assembly protein PET191
Representative CDS sequence Show only first row Show all	>Lus10032774 pacid=23158930 polypeptide=Lus10032774 locus=Lus10032774.g ID=Lus10032774.BGIv1.0 annot-version=v1.0 ATGGCGAAGTCGTGCAAGGGACTCGCGATAGAACTCGTAAAGTGTCTCAGCGAATCCGACTGTGTCAAAGTTGAGAACCGATCCATCAGGGATTGTGCCG GAGAGAAGAGCCCCTGCGTTCCCAGCGAGTGCGTTGGACTCCGGGAAACCTATTTCAACTGCAAGAGAGGCCAGGATCCTGTTTCCACAAGAGAGATCCG TGAAACCCTTTCCAAAGCATTGCAAGGGTTCTGA
AA sequence Show only first row Show all	>Lus10032774 pacid=23158930 polypeptide=Lus10032774 locus=Lus10032774.g ID=Lus10032774.BGIv1.0 annot-version=v1.0 MAKSCKGLAIELVKCLSESDCVKVENRSIRDCAGEKSPCVPSECVGLRETYFNCKRGQDPVSTREIRETLSKALQGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G10865			unknown protein		Lus10032774 [exp]	0	1
AT5G02930			F-box/RNI-like superfamily pro...		Lus10029589 [exp]	6.6	0.7964
AT5G58005			Cytochrome c oxidase, subunit ...		Lus10036285 [exp]	9.5	0.7498
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10008095 [exp]	10.3	0.7841
AT1G10890			unknown protein		Lus10043141 [exp]	20.3	0.7820
AT1G64970		VTE4, TMT1, G-T...	VITAMIN E DEFICIENT 4, gamma-t...		Lus10020357 [exp]	27.1	0.6972
AT2G45520			unknown protein		Lus10015859 [exp]	30.9	0.7661
AT3G25210			Tetratricopeptide repeat (TPR)...		Lus10038215 [exp]	33.1	0.7593
					Lus10031226 [exp]	39.5	0.7472
AT4G14965		ATMAPR4	membrane-associated progestero...		Lus10018026 [exp]	42.2	0.7447
AT5G09920		NRPB4, ATRPB15....	RNA polymerase II, Rpb4, core ...		Lus10005796 [exp]	43.0	0.7135

Compare expression of checked genes

Lus10032774 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.