Lus10032779 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10032779 pacid=23158978 polypeptide=Lus10032779 locus=Lus10032779.g ID=Lus10032779.BGIv1.0 annot-version=v1.0
ATGGTGAAGTGGATGATCCGCCCTCCTCGTCAGGATCCACGGGATTTTCGGGGAGGTGTATCTGAAGAAGTTAATGGAACAAGAACCAAAGCTAAGGATG
TTCAGGCTAGAGTTGAACTTATGGTATGGTTCAGTCCCCGCACATCGACCCAAGGTCTGGTCGTAGAAGAGATTGGCGGTGAAGGAGAAAAGGTTTTCTA
CGGAGATCCATTGGCATCTTCAAGTTCTGCGGGAACAAGGTCAACGACACCAGGGGTTATCAACCTGGAATGGAAGAAAGATGATGTCCAATGTCAACCC
TTGGCTCCTGATACTACAGAGGATGCTGATACTACAGAGGTTGATGGTACTACTGCCGAGGAAGCTTCTCAGGCACACCTTGCAATTGACATGGCTTAG
AA sequence
>Lus10032779 pacid=23158978 polypeptide=Lus10032779 locus=Lus10032779.g ID=Lus10032779.BGIv1.0 annot-version=v1.0
MVKWMIRPPRQDPRDFRGGVSEEVNGTRTKAKDVQARVELMVWFSPRTSTQGLVVEEIGGEGEKVFYGDPLASSSSAGTRSTTPGVINLEWKKDDVQCQP
LAPDTTEDADTTEVDGTTAEEASQAHLAIDMA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10032779 0 1
AT5G14180 MPL1 Myzus persicae-induced lipase ... Lus10035218 1.4 0.7485
AT1G73890 Bifunctional inhibitor/lipid-t... Lus10032488 1.7 0.7916
AT2G15220 Plant basic secretory protein ... Lus10019802 14.0 0.6962
AT5G01750 Protein of unknown function (D... Lus10014154 15.9 0.6684
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10030078 24.1 0.7083
AT1G14590 Nucleotide-diphospho-sugar tra... Lus10017982 33.8 0.6126
AT2G02990 RNS1, ATRNS1 ribonuclease 1 (.1) Lus10035881 45.7 0.6887
AT2G24100 ASG1 ALTERED SEED GERMINATION 1, un... Lus10024256 61.9 0.6013
AT3G04070 NAC ANAC047 NAC domain containing protein ... Lus10036959 82.4 0.6037
AT4G35160 O-methyltransferase family pro... Lus10032304 91.9 0.5658

Lus10032779 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.