Lus10032782 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G14460 56 / 4e-09 LRR and NB-ARC domains-containing disease resistance protein (.1)
AT3G14470 54 / 1e-08 NB-ARC domain-containing disease resistance protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003571 319 / 5e-104 AT3G14470 363 / 6e-110 NB-ARC domain-containing disease resistance protein (.1)
Lus10002609 211 / 2e-63 AT3G14470 364 / 9e-110 NB-ARC domain-containing disease resistance protein (.1)
Lus10004127 199 / 2e-59 AT3G14470 350 / 5e-105 NB-ARC domain-containing disease resistance protein (.1)
Lus10004126 199 / 2e-59 AT3G14470 353 / 6e-106 NB-ARC domain-containing disease resistance protein (.1)
Lus10022900 181 / 8e-53 AT3G14470 350 / 2e-104 NB-ARC domain-containing disease resistance protein (.1)
Lus10011856 150 / 1e-45 AT3G14460 76 / 5e-16 LRR and NB-ARC domains-containing disease resistance protein (.1)
Lus10029705 151 / 9e-45 AT3G14460 112 / 5e-27 LRR and NB-ARC domains-containing disease resistance protein (.1)
Lus10022792 151 / 3e-42 AT3G14470 343 / 7e-102 NB-ARC domain-containing disease resistance protein (.1)
Lus10020361 100 / 1e-25 AT3G03470 67 / 2e-12 "cytochrome P450, family 87, subfamily A, polypeptide 9", cytochrome P450, family 87, subfamily A, polypeptide 9 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G025400 98 / 7e-24 AT3G14470 558 / 0.0 NB-ARC domain-containing disease resistance protein (.1)
Potri.008G212200 89 / 1e-20 AT3G14470 392 / 8e-121 NB-ARC domain-containing disease resistance protein (.1)
Potri.014G003200 85 / 3e-19 AT3G14470 352 / 4e-103 NB-ARC domain-containing disease resistance protein (.1)
Potri.001G261600 85 / 4e-19 AT3G14470 628 / 0.0 NB-ARC domain-containing disease resistance protein (.1)
Potri.012G121876 82 / 3e-18 AT3G14470 404 / 6e-125 NB-ARC domain-containing disease resistance protein (.1)
Potri.001G022800 82 / 4e-18 AT3G14470 168 / 1e-43 NB-ARC domain-containing disease resistance protein (.1)
Potri.012G121851 81 / 5e-18 AT3G14470 348 / 2e-105 NB-ARC domain-containing disease resistance protein (.1)
Potri.017G121500 81 / 9e-18 AT3G14470 483 / 9e-153 NB-ARC domain-containing disease resistance protein (.1)
Potri.014G012000 80 / 2e-17 AT3G14470 367 / 7e-109 NB-ARC domain-containing disease resistance protein (.1)
Potri.017G121700 79 / 3e-17 AT3G14470 461 / 2e-144 NB-ARC domain-containing disease resistance protein (.1)
PFAM info
Representative CDS sequence
>Lus10032782 pacid=23159047 polypeptide=Lus10032782 locus=Lus10032782.g ID=Lus10032782.BGIv1.0 annot-version=v1.0
ATGAACCAACTCCAGGGACTTCTTTGTGTGTGTGGTCTAAGTAATGTGGCAGAGAGTTATGAGGCGGAACAAGCTGATTTTGCCCGAAAAATATCGCTGA
CCAGTTTAGTTCTTGAATTTAAAGATTATAAAGGTAACATTGGCGATGATAAGGATGAAGTATTGTTGGAAGCGGTAAGACCATCCACCAACTTGGAAGA
ACTGATTATAACTCGTTATATGGGTGCTTCGGTATCTCCGACCTGGATGGGGTTGCTCTCTACCTTAGCTCGCCTTTCATTTATGTATTGCTACAAGGTG
AAGTATCTGCCTCCTTTAGGCCATCTGCGGTCTCTCGAAAAACTGTCATTCTTGGGAATGATCAAAGTAAAGAATATAGGTGTTGAGCTTCTTGGACATT
ATATTGGAGCATTTCCAAGGTTGACGCTGCTGATATTTGAATGTATGTGGGAGTGGGAAGAGTGGGATGATACGATATTATCATCACCATCAGTGATGCC
TCGGCTAAGTTACTTGAAATTGCGCTGCTGCAAGCAGCTAAAGAAGTTGCCGATGCAATTCTCGAGAAACCGACACTAG
AA sequence
>Lus10032782 pacid=23159047 polypeptide=Lus10032782 locus=Lus10032782.g ID=Lus10032782.BGIv1.0 annot-version=v1.0
MNQLQGLLCVCGLSNVAESYEAEQADFARKISLTSLVLEFKDYKGNIGDDKDEVLLEAVRPSTNLEELIITRYMGASVSPTWMGLLSTLARLSFMYCYKV
KYLPPLGHLRSLEKLSFLGMIKVKNIGVELLGHYIGAFPRLTLLIFECMWEWEEWDDTILSSPSVMPRLSYLKLRCCKQLKKLPMQFSRNRH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G14460 LRR and NB-ARC domains-contain... Lus10032782 0 1
AT3G60890 ZPR2 LITTLE ZIPPER 2, protein bindi... Lus10006673 19.6 0.8203
AT5G08640 ATFLS1, FLS flavonol synthase 1 (.1.2) Lus10028068 26.7 0.8091
AT1G48880 TBL7 TRICHOME BIREFRINGENCE-LIKE 7 ... Lus10042789 29.0 0.8267
AT3G14470 NB-ARC domain-containing disea... Lus10003571 33.9 0.8149
AT2G45140 PVA12 plant VAP homolog 12 (.1) Lus10000032 57.7 0.7952
AT4G35020 ROP6, ARAC3, RH... RHO-RELATED PROTEIN FROM PLANT... Lus10039899 59.5 0.8093
Lus10024940 64.8 0.8086
AT3G60890 ZPR2 LITTLE ZIPPER 2, protein bindi... Lus10007017 80.0 0.7970
Lus10026494 108.9 0.7919
Lus10010415 125.0 0.7365

Lus10032782 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.