Lus10032788 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029617 258 / 9e-90 ND /
Lus10032770 241 / 3e-83 ND /
Lus10029619 205 / 3e-69 ND /
Lus10042684 204 / 5e-69 ND /
Lus10003753 127 / 3e-38 ND /
Lus10003755 121 / 4e-36 ND 37 / 0.002
Lus10008314 117 / 2e-34 ND /
Lus10003754 116 / 3e-34 AT1G04520 39 / 3e-04 plasmodesmata-located protein 2 (.1)
Lus10035753 115 / 5e-33 ND /
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10032788 pacid=23159045 polypeptide=Lus10032788 locus=Lus10032788.g ID=Lus10032788.BGIv1.0 annot-version=v1.0
ATGGTTTATGTGTCGAAATTGGCTGCAACTACCACATTTCTAATTCTGGCTACTTTGATTATTGTGGTCATGGTCGAGGGTGCAGACAAGAGCGTCATCA
ATGGGCCATACTGTATCAAGAAATCCTTCGACAGGGATTACAACAGGAATGCAAAACGTCTCATGGATATCCTTGTTGATGAAACTCGGGACAAGTATAA
GATGAGGGATCATGAGGAATACAGGTACTATCATAGCTACCCAAATAAGGACTTGGGTTCCGTCCTTGGTGGTGGGTATTGCGTTGGACACCTCTCGAAA
TGGGGATGTGGCAGTTGCCTTGGCTCTGCTAGGGACAAAATCAAATCCCGTTGCGATCATACATTTGAGGCCAGTGTTCAACTCACAGATTGTTCCCTTT
GGTTCAGGAAGATTGTTAACAACACAAAACAGATTGAGTACTAG
AA sequence
>Lus10032788 pacid=23159045 polypeptide=Lus10032788 locus=Lus10032788.g ID=Lus10032788.BGIv1.0 annot-version=v1.0
MVYVSKLAATTTFLILATLIIVVMVEGADKSVINGPYCIKKSFDRDYNRNAKRLMDILVDETRDKYKMRDHEEYRYYHSYPNKDLGSVLGGGYCVGHLSK
WGCGSCLGSARDKIKSRCDHTFEASVQLTDCSLWFRKIVNNTKQIEY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10032788 0 1
AT1G30050 unknown protein Lus10035609 7.6 0.9352
AT3G03080 Zinc-binding dehydrogenase fam... Lus10003638 10.7 0.9337
AT4G03220 Protein with RNI-like/FBD-like... Lus10023567 14.0 0.9273
AT1G04645 Plant self-incompatibility pro... Lus10002219 16.1 0.9273
Lus10028460 16.9 0.8274
Lus10009618 18.0 0.9273
Lus10005830 19.7 0.9273
AT1G75790 SKS18 SKU5 similar 18 (.1) Lus10013556 21.3 0.9273
AT5G59810 ATSBT5.4 Subtilase family protein (.1) Lus10039085 22.8 0.9273
AT2G03220 ATFUT1, ATFT1, ... MURUS 2, ARABIDOPSIS THALIANA ... Lus10024077 24.2 0.9273

Lus10032788 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.