Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05920 99 / 2e-26 DHS, EDA22 embryo sac development arrest 22, deoxyhypusine synthase (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029688 [exp] 126 / 2e-35 AT5G05920 657 / 0.0 embryo sac development arrest 22, deoxyhypusine synthase (.1.2) Lus10042728 [exp] 123 / 2e-35 AT5G05920 629 / 0.0 embryo sac development arrest 22, deoxyhypusine synthase (.1.2) Lus10020239 [exp] 100 / 1e-27 AT5G05920 181 / 2e-55 embryo sac development arrest 22, deoxyhypusine synthase (.1.2) Lus10028867 [exp] 61 / 4e-12 AT5G04850 399 / 7e-139 SNF7 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G186900 [exp] 100 / 1e-26 AT5G05920 651 / 0.0 embryo sac development arrest 22, deoxyhypusine synthase (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032793 pacid=23158965 polypeptide=Lus10032793 locus=Lus10032793.g ID=Lus10032793.BGIv1.0 annot-version=v1.0 ATGGAGAAGAACCTACCCTCATCCATCCATGCTAGCGTGTTCAGAGAATCGGAGTCTCTGGACGGAAAATCTAATAAGTTAAAAGGCTACGACTTCAACC AAAGAGTTGATTACCCTCAGCTTCTCAAATCAATGCTCTCAACTGGCTTCCAAGCTTCCAACCTCGGCGACGCTATTTCAGTCAGTCTTGCTGACAAGCT CGTTGCTGACGACGAGAAAGACCCTGCTTATAGAGAACCTGTGGGTGCATAA
AA sequence Show only first row Show all	>Lus10032793 pacid=23158965 polypeptide=Lus10032793 locus=Lus10032793.g ID=Lus10032793.BGIv1.0 annot-version=v1.0 MEKNLPSSIHASVFRESESLDGKSNKLKGYDFNQRVDYPQLLKSMLSTGFQASNLGDAISVSLADKLVADDEKDPAYREPVGA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05920		DHS, EDA22	embryo sac development arrest ...		Lus10032793 [exp]	0	1
AT1G21430		YUC11	Flavin-binding monooxygenase f...		Lus10000677 [exp]	3.9	1.0000
AT2G15220			Plant basic secretory protein ...		Lus10001608 [exp]	5.5	1.0000
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10005144 [exp]	6.7	1.0000
					Lus10024141 [exp]	7.7	1.0000
AT5G06720		ATPA2	peroxidase 2 (.1)		Lus10027988 [exp]	8.7	1.0000
					Lus10013255 [exp]	9.5	1.0000
					Lus10013259 [exp]	10.2	1.0000
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10013964 [exp]	11.0	1.0000
AT3G06240			F-box family protein (.1)		Lus10014136 [exp]	11.6	1.0000
					Lus10028570 [exp]	12.2	1.0000

Compare expression of checked genes

Lus10032793 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.