Lus10032797 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32070 42 / 5e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 41 / 9e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT1G06450 40 / 0.0002 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 39 / 0.0003 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000327 73 / 4e-16 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10008043 70 / 6e-15 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035078 69 / 1e-14 AT1G06450 168 / 2e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017895 66 / 3e-14 AT1G06450 98 / 4e-26 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10001651 62 / 6e-12 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035077 61 / 2e-11 AT1G61470 162 / 6e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017905 59 / 6e-11 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10007771 59 / 7e-11 AT1G61470 170 / 5e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029710 46 / 2e-06 AT5G10960 147 / 2e-42 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G040400 46 / 1e-06 AT5G22250 253 / 4e-84 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 46 / 1e-06 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.001G046700 42 / 5e-05 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G038700 42 / 6e-05 AT1G61470 182 / 8e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G186300 42 / 6e-05 AT5G22250 261 / 9e-87 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 39 / 0.0003 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G262500 39 / 0.0005 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 38 / 0.0008 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10032797 pacid=23164793 polypeptide=Lus10032797 locus=Lus10032797.g ID=Lus10032797.BGIv1.0 annot-version=v1.0
ATGGATTCTTTTCATGTGAGGGAAGTCTGGAACGATAACTCGATCCATGAATTGAAAGCCATGGAAGAATGTCTAACGAAGTATCCAGTTGTGTCGGCCG
ACTCCGAATTCCAAGGCTTCCTCCGTCCCACTCCAAGGAACTTCGACTCCAGCATGCCACGTCAATCGATCACAACGACGCCAGCGACAAGCAACCCGTC
CATCGAACGCAAAGGGCCAGCCGCTCCTAGTGGCTATACCACGAGTGCAAAATCCGGCGATGACAAGGAGCTCGGAAACGTTAGGGGGATCAACTCCGAT
GAACCCCATGTTGACACAACCAAGAGTGGTTCTGGAATTGTCCCAATCGAACTTGGGGATCCTCAGTCCAAAGCTTGTTGCTTGGAGAGAGCGACAATGA
GGAATCCCTAA
AA sequence
>Lus10032797 pacid=23164793 polypeptide=Lus10032797 locus=Lus10032797.g ID=Lus10032797.BGIv1.0 annot-version=v1.0
MDSFHVREVWNDNSIHELKAMEECLTKYPVVSADSEFQGFLRPTPRNFDSSMPRQSITTTPATSNPSIERKGPAAPSGYTTSAKSGDDKELGNVRGINSD
EPHVDTTKSGSGIVPIELGDPQSKACCLERATMRNP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G80780 Polynucleotidyl transferase, r... Lus10032797 0 1
AT1G78610 MSL6 mechanosensitive channel of sm... Lus10023990 6.7 0.6090
AT1G73370 ATSUS6, SUS6 ARABIDOPSIS THALIANA SUCROSE S... Lus10020791 7.2 0.6902
AT1G21550 Calcium-binding EF-hand family... Lus10040888 9.2 0.5979
AT2G04880 WRKY ATWRKY1, ZAP1 zinc-dependent activator prote... Lus10006368 13.0 0.6159
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10025506 15.3 0.6827
Lus10011928 15.8 0.6703
AT3G19340 Protein of unknown function (D... Lus10012584 21.2 0.6221
AT2G36540 Haloacid dehalogenase-like hyd... Lus10019760 25.8 0.6331
AT4G23350 Protein of Unknown Function (D... Lus10042273 34.3 0.6168
Lus10013743 36.5 0.6008

Lus10032797 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.