Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25010 39 / 0.0004 Aminotransferase-like, plant mobile domain family protein (.1) AT2G04865 38 / 0.0005 Aminotransferase-like, plant mobile domain family protein (.1) AT1G17930 37 / 0.0008 Aminotransferase-like, plant mobile domain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008465 [exp] 114 / 1e-33 AT2G04865 49 / 2e-07 Aminotransferase-like, plant mobile domain family protein (.1) Lus10009805 [exp] 108 / 6e-30 AT2G25010 54 / 6e-08 Aminotransferase-like, plant mobile domain family protein (.1) Lus10008144 [exp] 70 / 5e-16 AT1G17930 54 / 4e-10 Aminotransferase-like, plant mobile domain family protein (.1) Lus10023395 [exp] 70 / 6e-16 AT1G17930 52 / 4e-08 Aminotransferase-like, plant mobile domain family protein (.1) Lus10033258 [exp] 67 / 2e-15 AT1G17930 56 / 3e-10 Aminotransferase-like, plant mobile domain family protein (.1) Lus10002099 [exp] 57 / 2e-11 ND 39 / 7e-04 Lus10005957 [exp] 47 / 4e-07 AT1G48120 75 / 1e-14 hydrolases;protein serine/threonine phosphatases (.1) Lus10014633 [exp] 45 / 1e-06 AT2G04865 61 / 2e-11 Aminotransferase-like, plant mobile domain family protein (.1) Lus10006165 [exp] 45 / 1e-06 AT5G45260 66 / 5e-12 SENSITIVE TO LOW HUMIDITY 1, RESISTANT TO RALSTONIA SOLANACEARUM 1, ARABIDOPSIS THALIANA WRKY DOMAIN PROTEIN 52, Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10536 [flax] [poplar] PMD Plant mobile domain
Representative CDS sequence Show only first row Show all	>Lus10032799 pacid=23164839 polypeptide=Lus10032799 locus=Lus10032799.g ID=Lus10032799.BGIv1.0 annot-version=v1.0 ATGCATGTAGACAGAGTTCTATTGGCAACAGCGTCGGGTGAGCTCCCTGATGCCGACACCGCCAGTTGCTACTTGTTCAGTTTGCTTGCGTCTGCTCTAT TTGTGGATAGTAGTGGGGGCCTGGGTGGTCGTGTTAGCATCTTGGAGGGTATTAGTGACATCGACAGGGTGAGCAGCTACAGTTGGGGAGCCGCTGCACT TGCCTTTATGTACATGCAGTTACGGATAGCTAGTCGGGCATCATCGACATCACTGTGCGGGTGTCTAACTCTGTTGCAGTCTTGGATGATCCTGTTCGTG TCCTTCGTCAGTATGGGTACCGATAGGTGA
AA sequence Show only first row Show all	>Lus10032799 pacid=23164839 polypeptide=Lus10032799 locus=Lus10032799.g ID=Lus10032799.BGIv1.0 annot-version=v1.0 MHVDRVLLATASGELPDADTASCYLFSLLASALFVDSSGGLGGRVSILEGISDIDRVSSYSWGAAALAFMYMQLRIASRASSTSLCGCLTLLQSWMILFV SFVSMGTDR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G04865			Aminotransferase-like, plant m...		Lus10032799 [exp]	0	1
AT1G49340		ATPI4K ALPHA, A...	Phosphatidylinositol 3- and 4-...		Lus10011315 [exp]	1.0	0.9704
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10001065 [exp]	1.4	0.9693
AT5G25120		CYP71B11	"ytochrome p450, family 71, su...		Lus10004408 [exp]	4.9	0.7942
AT3G63380			ATPase E1-E2 type family prote...		Lus10004087 [exp]	6.2	0.8140
AT4G15780		ATVAMP724	vesicle-associated membrane pr...		Lus10037511 [exp]	10.9	0.6027
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Lus10026877 [exp]	12.2	0.7964
					Lus10033844 [exp]	13.3	0.7615
					Lus10000400 [exp]	13.6	0.7964
AT2G48060			unknown protein		Lus10035351 [exp]	13.6	0.6465
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10029390 [exp]	14.9	0.7964

Compare expression of checked genes

Lus10032799 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.