Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032802 pacid=23164828 polypeptide=Lus10032802 locus=Lus10032802.g ID=Lus10032802.BGIv1.0 annot-version=v1.0 ATGGATGGCGGATCGGTAGGAAACTCGAGGGATCTACCAGACACAAGAACTCGTGATTTGGATTCAGCCTATGGAGTAACTCAGTGGGGAATCGACAAAG GTAACCCTGGACCCTCAATCTCTAGGTGTCATCTCTATGTTGGCTTTACTATTCTTTTCTGGGTGGTTCGAGAAGTGCTCGTTTCGGATGCTCGAGAGGA TGACGATGTTGGTGTCAATGGTTCGGTGAGGCCGAGTGTCACTGAGTGCAGTTGA
AA sequence Show only first row Show all	>Lus10032802 pacid=23164828 polypeptide=Lus10032802 locus=Lus10032802.g ID=Lus10032802.BGIv1.0 annot-version=v1.0 MDGGSVGNSRDLPDTRTRDLDSAYGVTQWGIDKGNPGPSISRCHLYVGFTILFWVVREVLVSDAREDDDVGVNGSVRPSVTECS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10032802 [exp]	0	1
AT4G08690			Sec14p-like phosphatidylinosit...		Lus10020911 [exp]	5.2	0.8825
AT1G54650			Methyltransferase family prote...		Lus10005515 [exp]	10.7	0.8763
AT5G54890			RNA-binding CRS1 / YhbY (CRM) ...		Lus10019623 [exp]	16.4	0.8703
AT1G09300			Metallopeptidase M24 family pr...		Lus10010905 [exp]	18.0	0.8541
AT1G13960	WRKY	WRKY4	WRKY DNA-binding protein 4 (.1...		Lus10026634 [exp]	18.1	0.8727
AT2G02390		GST18, ATGSTZ1	GLUTATHIONE S-TRANSFERASE 18, ...		Lus10030274 [exp]	18.8	0.8752
AT5G48340			unknown protein		Lus10041085 [exp]	22.0	0.8780
AT5G27450		MVK, MK	mevalonate kinase (.1.2.3)		Lus10015168 [exp]	24.1	0.8812
AT2G39840		TOPP4	type one serine/threonine prot...		Lus10004692 [exp]	24.6	0.8688
AT1G49350			pfkB-like carbohydrate kinase ...		Lus10009862 [exp]	27.5	0.8411

Compare expression of checked genes

Lus10032802 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.