Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description ATCG00490 90 / 1e-22 ATCG00490.1, RBCL ribulose-bisphosphate carboxylases (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T124301 [exp] 106 / 5e-31 ATCG00490 180 / 4e-55 ribulose-bisphosphate carboxylases (.1) Potri.T005800 [exp] 106 / 6e-31 ATCG00490 184 / 7e-57 ribulose-bisphosphate carboxylases (.1) Potri.013G162700 [exp] 107 / 5e-29 ATCG00490 902 / 0.0 ribulose-bisphosphate carboxylases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02788 [flax] [poplar] RuBisCO_large_N Ribulose bisphosphate carboxylase large chain, N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10032825 pacid=23164795 polypeptide=Lus10032825 locus=Lus10032825.g ID=Lus10032825.BGIv1.0 annot-version=v1.0 ATGAGTTGTAGGGAGGGACTTATGTCACCACAAACAGAGACTAAAGCAAGTGTTGGATTCAAGGCTGGTGTTAAAGATTATAAATTAACTTATTATACTC CTGACTATGAAACCAAAGATACTGATATCTTGGCAGCATTCCGAGTAACTCCTCAACCAGGAGTTCCACCTGAGGAAGCGGGGGCGGCGGTAGCTGCTGA ATCTTCTACTGATATTTTATATCCATTTCCAATTCTTTTTAATTTTGGGTTCGGATAA
AA sequence Show only first row Show all	>Lus10032825 pacid=23164795 polypeptide=Lus10032825 locus=Lus10032825.g ID=Lus10032825.BGIv1.0 annot-version=v1.0 MSCREGLMSPQTETKASVGFKAGVKDYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTDILYPFPILFNFGFG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
ATCG00490		ATCG00490.1, RB...	ribulose-bisphosphate carboxyl...		Lus10032825 [exp]	0	1
ATCG00120		ATCG00120.1, AT...	ATP synthase subunit alpha (.1...		Lus10004894 [exp]	1.7	0.9826
ATCG00480		ATCG00480.1, AT...	ATP synthase subunit beta (.1)		Lus10032827 [exp]	2.8	0.9738
ATCG00680		ATCG00680.1, PS...	photosystem II reaction center...		Lus10006594 [exp]	3.5	0.9647
ATCG00480		ATCG00480.1, AT...	ATP synthase subunit beta (.1)		Lus10009173 [exp]	3.5	0.9704
ATCG00680		ATCG00680.1, PS...	photosystem II reaction center...		Lus10006593 [exp]	3.9	0.9627
ATCG00680		ATCG00680.1, PS...	photosystem II reaction center...		Lus10001686 [exp]	4.2	0.9548
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10025231 [exp]	4.5	0.8756
					Lus10040269 [exp]	4.9	0.9072
ATCG00480		ATCG00480.1, AT...	ATP synthase subunit beta (.1)		Lus10032826 [exp]	5.3	0.9501
					Lus10028567 [exp]	6.7	0.8895

Compare expression of checked genes

Lus10032825 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.