Lus10032826 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00480 218 / 5e-70 ATCG00480.1, ATPB ATP synthase subunit beta (.1)
AT5G08690 101 / 9e-26 ATP synthase alpha/beta family protein (.1)
AT5G08670 101 / 1e-25 ATP synthase alpha/beta family protein (.1)
AT5G08680 101 / 1e-25 ATP synthase alpha/beta family protein (.1)
ATCG00120 43 / 3e-05 ATCG00120.1, ATPA ATP synthase subunit alpha (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009173 271 / 3e-90 ATCG00480 890 / 0.0 ATP synthase subunit beta (.1)
Lus10034631 106 / 1e-27 AT5G08680 928 / 0.0 ATP synthase alpha/beta family protein (.1)
Lus10034632 106 / 1e-27 AT5G08680 875 / 0.0 ATP synthase alpha/beta family protein (.1)
Lus10035264 106 / 2e-27 AT5G08680 925 / 0.0 ATP synthase alpha/beta family protein (.1)
Lus10035263 97 / 5e-24 AT5G08680 782 / 0.0 ATP synthase alpha/beta family protein (.1)
Lus10024114 50 / 2e-08 AT5G08680 120 / 8e-33 ATP synthase alpha/beta family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G162800 231 / 5e-75 ATCG00480 927 / 0.0 ATP synthase subunit beta (.1)
Potri.008G126600 110 / 8e-29 AT5G08690 892 / 0.0 ATP synthase alpha/beta family protein (.1)
Potri.010G116600 108 / 3e-28 AT5G08690 871 / 0.0 ATP synthase alpha/beta family protein (.1)
Potri.013G138000 44 / 1e-05 ATCG00120 933 / 0.0 ATP synthase subunit alpha (.1)
Potri.007G062242 39 / 0.0006 ATMG01190 924 / 0.0 ATP synthase subunit 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0275 HAS-barrel PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain
Representative CDS sequence
>Lus10032826 pacid=23164852 polypeptide=Lus10032826 locus=Lus10032826.g ID=Lus10032826.BGIv1.0 annot-version=v1.0
ATGATGAAAATCAATCCTACTACTCCCGATCCCAGGATTTCCATTTTTGAGAAAACAGACCTGGGGCATATCGCTCAAATCATCGAACAAGTACTAGATA
TATATTTTCCCCGCGGAAAGATGCCTAATATTAACAATGCTCTCCTAGTTAAAGGTCAAGACTCCGCCGGTCCACAAATTAATGTGACTTGTGAAGTACA
GCAATTATTAGGAAATAATAAAATTCGGGCTGTAGCTATGAGTGCTACAGATGGTTTAATGAGAGGAATGGAAGTGAGCGACACGGGAGCTCCTCTAAGT
GTTCCGGTCGGTGGAGCAACTTTAGGACGAATTTTCAACGTGCTTGGAGAACCTATTGATGATTTAGGTCCGGTAGATACTTGCACAACATCCCCTATTC
ATAGATCTGCGCCCGCCTTTATATAG
AA sequence
>Lus10032826 pacid=23164852 polypeptide=Lus10032826 locus=Lus10032826.g ID=Lus10032826.BGIv1.0 annot-version=v1.0
MMKINPTTPDPRISIFEKTDLGHIAQIIEQVLDIYFPRGKMPNINNALLVKGQDSAGPQINVTCEVQQLLGNNKIRAVAMSATDGLMRGMEVSDTGAPLS
VPVGGATLGRIFNVLGEPIDDLGPVDTCTTSPIHRSAPAFI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Lus10032826 0 1
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Lus10009173 1.4 0.9939
ATCG00480 ATCG00480.1, AT... ATP synthase subunit beta (.1) Lus10032827 2.0 0.9912
ATCG00120 ATCG00120.1, AT... ATP synthase subunit alpha (.1... Lus10004894 3.5 0.9705
ATCG00500 ATCG00500.1, AC... acetyl-CoA carboxylase carboxy... Lus10002473 4.5 0.9406
ATCG00160 ATCG00160.1, RP... ribosomal protein S2 (.1) Lus10013628 5.3 0.9157
ATCG00490 ATCG00490.1, RB... ribulose-bisphosphate carboxyl... Lus10032825 5.3 0.9501
AT3G42860 zinc knuckle (CCHC-type) famil... Lus10012985 5.7 0.9130
ATCG00680 ATCG00680.1, PS... photosystem II reaction center... Lus10006593 6.5 0.9229
ATCG00680 ATCG00680.1, PS... photosystem II reaction center... Lus10001686 7.9 0.9110
ATCG00680 ATCG00680.1, PS... photosystem II reaction center... Lus10006594 9.5 0.9014

Lus10032826 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.