Lus10032831 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10032831 pacid=23164803 polypeptide=Lus10032831 locus=Lus10032831.g ID=Lus10032831.BGIv1.0 annot-version=v1.0
ATGGAAGATACTCAAGAGTATCCACTGTTTGATCCCTTCTACCTTCATGGAAACGAGCAGCCAGGCTTTTCGTTGGTCACTGACAAACTTACAACATCAA
TTACACAGATTGGAGTCGTGATGTTTATTTACAATGCTCTTGGAGCCAAGAACAAGCGTGGACTCGTTGATGGCACCACCGAGGAACTAAAATATGTTGA
TATAAAGTTCTGGTCATGGACCATATGCAACATCGTGGTGCTTTCAGGGTTGCAGCAGTATGTAGATCCAGGGAATATGAGAATGCAACATCTTGGCAAA
GCTTGA
AA sequence
>Lus10032831 pacid=23164803 polypeptide=Lus10032831 locus=Lus10032831.g ID=Lus10032831.BGIv1.0 annot-version=v1.0
MEDTQEYPLFDPFYLHGNEQPGFSLVTDKLTTSITQIGVVMFIYNALGAKNKRGLVDGTTEELKYVDIKFWSWTICNIVVLSGLQQYVDPGNMRMQHLGK
A

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10032831 0 1
AT2G20340 Pyridoxal phosphate (PLP)-depe... Lus10018522 9.0 0.8167
AT2G29670 Tetratricopeptide repeat (TPR)... Lus10025981 9.1 0.7763
AT5G51740 Peptidase family M48 family pr... Lus10032437 11.1 0.7763
AT5G22460 alpha/beta-Hydrolases superfam... Lus10004882 12.8 0.7763
AT5G14210 Leucine-rich repeat protein ki... Lus10041589 13.1 0.6311
AT5G49180 Plant invertase/pectin methyle... Lus10023775 13.6 0.6699
AT1G66950 ABCG39, PDR11, ... ATP-binding cassette G39, plei... Lus10006277 14.3 0.7763
AT4G33920 Protein phosphatase 2C family ... Lus10000700 15.7 0.7763
AT4G20060 EMB1895 EMBRYO DEFECTIVE 1895, ARM rep... Lus10038371 16.9 0.7763
AT1G01450 Protein kinase superfamily pro... Lus10041113 18.1 0.7763

Lus10032831 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.