Lus10032837 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10032837 pacid=23164843 polypeptide=Lus10032837 locus=Lus10032837.g ID=Lus10032837.BGIv1.0 annot-version=v1.0
ATGGCTCTGCCACTGTTTGGTATGGGAAAGGTCAAATTTTCAGAGTTAACTTTTAGGCTTGAAATTCCGCTCAGTGTCTTCGATCATCCTAGTTCCGCCA
TTATCTCTGGGTTTGAGTTAGGAGGAGCGGAGGATTCTATCACCATGCTTGTTCATCTCTTGATCGAGCAGAGTGATTATGTCGATATGCTTAGTGCAAG
CAAGATATTAGGAGTAGGTGTATTAGCGATTCTAATTTTATGTACCTTTCACCTTTGGAATGTCCTTTGTGTTTTGATCGATGCTGATGTTGTGGTTTTC
TGCTTCTTTGCAAGGTGGCTCCAATAG
AA sequence
>Lus10032837 pacid=23164843 polypeptide=Lus10032837 locus=Lus10032837.g ID=Lus10032837.BGIv1.0 annot-version=v1.0
MALPLFGMGKVKFSELTFRLEIPLSVFDHPSSAIISGFELGGAEDSITMLVHLLIEQSDYVDMLSASKILGVGVLAILILCTFHLWNVLCVLIDADVVVF
CFFARWLQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10032837 0 1
AT3G52780 ATPAP20, PAP20 Purple acid phosphatases super... Lus10017057 8.1 0.6497
AT4G35280 C2H2ZnF DAZ2 DUO1-ACTIVATED ZINC FINGER 2, ... Lus10023932 37.5 0.4967
AT1G30190 unknown protein Lus10038508 60.0 0.4951
AT4G26270 PFK3 phosphofructokinase 3 (.1) Lus10035001 67.5 0.5151
Lus10004507 114.0 0.4831
AT5G53840 F-box/RNI-like/FBD-like domain... Lus10025675 175.7 0.4568
AT1G60400 F-box/RNI-like superfamily pro... Lus10038935 176.1 0.4568
AT3G15850 JB67, FADB, ADS... FATTY ACID DESATURASE B, fatty... Lus10034969 188.0 0.4613
Lus10041324 192.0 0.4780

Lus10032837 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.