Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66540 194 / 3e-61 Cytochrome P450 superfamily protein (.1.2) AT4G37360 194 / 1e-59 CYP81D2 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) AT4G37370 190 / 5e-58 CYP81D8 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) AT4G37320 187 / 7e-57 CYP81D5 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) AT3G28740 184 / 1e-55 CYP81D11, CYP81D1 cytochrome P450, family 81, subfamily D, polypeptide 11, Cytochrome P450 superfamily protein (.1) AT4G37340 182 / 5e-55 CYP81D3 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) AT4G37330 181 / 2e-54 CYP81D4 "cytochrome P450, family 81, subfamily D, polypeptide 4", cytochrome P450, family 81, subfamily D, polypeptide 4 (.1) AT4G37430 179 / 6e-54 CYP81F1, CYP91A2 "cytochrome P450, family 91, subfamily A, polypeptide 2", CYTOCHROME P450 MONOOXYGENASE 81F1, cytochrome P450, family 91, subfamily A, polypeptide 2 (.1) AT4G37400 179 / 1e-53 CYP81F3 "cytochrome P450, family 81, subfamily F, polypeptide 3", cytochrome P450, family 81, subfamily F, polypeptide 3 (.1) AT5G36220 176 / 9e-53 CYP91A1, CYP81D1 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018711 [exp] 249 / 1e-80 AT4G37370 441 / 5e-151 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10018712 [exp] 201 / 2e-64 AT4G37340 279 / 8e-94 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) Lus10018717 [exp] 194 / 4e-59 AT4G37370 533 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10020437 [exp] 192 / 1e-58 AT4G37370 630 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10027798 [exp] 186 / 4e-58 AT5G06900 349 / 1e-117 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Lus10024816 [exp] 189 / 2e-57 AT4G37370 506 / 2e-176 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10027614 [exp] 184 / 6e-56 AT4G37370 496 / 6e-174 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10011958 [exp] 185 / 8e-56 AT5G36220 548 / 0.0 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10035502 [exp] 184 / 2e-55 AT5G06900 533 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G121400 [exp] 218 / 9e-69 AT4G37370 470 / 1e-162 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121100 [exp] 217 / 3e-68 AT4G37370 429 / 2e-146 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121200 [exp] 216 / 5e-68 AT4G37340 465 / 1e-160 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) Potri.014G020500 [exp] 208 / 6e-65 AT4G37370 462 / 2e-159 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020432 [exp] 199 / 2e-61 AT4G37370 440 / 4e-151 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020600 [exp] 197 / 8e-61 AT4G37370 479 / 4e-166 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G021700 [exp] 192 / 2e-58 AT5G10600 436 / 7e-149 "cytochrome P450, family 81, subfamily K, polypeptide 2", cytochrome P450, family 81, subfamily K, polypeptide 2 (.1) Potri.003G118200 [exp] 184 / 2e-55 AT2G45550 438 / 9e-150 "cytochrome P450, family 76, subfamily C, polypeptide 4", cytochrome P450, family 76, subfamily C, polypeptide 4 (.1) Potri.016G049800 [exp] 181 / 2e-54 AT5G06900 536 / 0.0 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1) Potri.005G037100 [exp] 178 / 3e-53 AT5G06900 383 / 4e-128 "cytochrome P450, family 93, subfamily D, polypeptide 1", cytochrome P450, family 93, subfamily D, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10032856 pacid=23164841 polypeptide=Lus10032856 locus=Lus10032856.g ID=Lus10032856.BGIv1.0 annot-version=v1.0 ATGCAGGATCTGTTGTCAGCGGGGACAGATACATCATCAAATACGATGGAATGGGCACTGTCACTCCTCCTCCATAATCCTTCAGCTTTAACCAAAGCCC AGTCCGAAATCCAAAGAGTGGTTGGAAACGATCGATTAGTGGAAGAAACCGACATCCCTAAACTGGAGTATCTTCAGGGGATAATAAAAGAGACACTTAG AATACACCCAGCACTTCCCTTGCTAGTTCCTCACGAATCATCTCACGAATGCGAGGTGGGAGGTTATAAAGTGCCTAGCAACACAATCTTGTTGATTAAC ACTTGGAACATTCATAACCACCCAAAAATTTGGAAGGATCCACATGAATTCAAGCCAGAGAGGTTTCTAGGAGGAGGAGGAGGCAATAAGGAAAGTGATG ATCATCATGGTTTGAGGTTTTTGCCGTTTGGGTATGGCAGGAGGAGTTGTCCTGGTGAAGGATTGGGGATGAAGATGGTGAGCTTCACGTTGAGTGCGTT GATTCAGTGCTTTGATTTCGATTGTGTCGACGGAGTTGTAGATATGACTGTACAAACTGGGTTTACCATGGCTAAAGCTCTGCCTCTTAGAGTTGTACCG CGCCCTCGTCCAGCCATGTTGCATTTGCTATCTCGAGTTTGA
AA sequence Show only first row Show all	>Lus10032856 pacid=23164841 polypeptide=Lus10032856 locus=Lus10032856.g ID=Lus10032856.BGIv1.0 annot-version=v1.0 MQDLLSAGTDTSSNTMEWALSLLLHNPSALTKAQSEIQRVVGNDRLVEETDIPKLEYLQGIIKETLRIHPALPLLVPHESSHECEVGGYKVPSNTILLIN TWNIHNHPKIWKDPHEFKPERFLGGGGGNKESDDHHGLRFLPFGYGRRSCPGEGLGMKMVSFTLSALIQCFDFDCVDGVVDMTVQTGFTMAKALPLRVVP RPRPAMLHLLSRV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G66540			Cytochrome P450 superfamily pr...		Lus10032856 [exp]	0	1
AT4G15910		ATDI21	drought-induced 21 (.1)		Lus10006508 [exp]	4.1	0.9032
AT2G14210	MADS	AGL44, ANR1	ARABIDOPSIS NITRATE REGULATED ...		Lus10028214 [exp]	4.9	0.9297
AT1G63380			NAD(P)-binding Rossmann-fold s...		Lus10007038 [exp]	6.2	0.9310
AT1G54650			Methyltransferase family prote...		Lus10006576 [exp]	7.5	0.9284
AT1G26665			Mediator complex, subunit Med1...		Lus10024211 [exp]	9.5	0.9034
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Lus10032857 [exp]	9.9	0.9119
AT1G24530			Transducin/WD40 repeat-like su...		Lus10006460 [exp]	10.0	0.9154
AT2G38300	GARP		myb-like HTH transcriptional r...		Lus10012239 [exp]	12.6	0.9237
AT1G29280	WRKY	ATWRKY65, WRKY6...	WRKY DNA-binding protein 65 (....		Lus10029252 [exp]	12.6	0.9257
AT5G61970			signal recognition particle-re...		Lus10032538 [exp]	14.0	0.9069

Compare expression of checked genes

Lus10032856 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.