Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37370 196 / 8e-59 CYP81D8 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) AT4G37340 191 / 1e-56 CYP81D3 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) AT2G23220 186 / 1e-54 CYP81D6 "cytochrome P450, family 81, subfamily D, polypeptide 6", cytochrome P450, family 81, subfamily D, polypeptide 6 (.1) AT4G37320 183 / 5e-54 CYP81D5 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) AT4G37330 176 / 3e-51 CYP81D4 "cytochrome P450, family 81, subfamily D, polypeptide 4", cytochrome P450, family 81, subfamily D, polypeptide 4 (.1) AT5G36220 175 / 8e-51 CYP91A1, CYP81D1 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) AT2G23190 175 / 2e-50 CYP81D7 "cytochrome P450, family 81, subfamily D, polypeptide 7", cytochrome P450, family 81, subfamily D, polypeptide 7 (.1) AT4G37410 173 / 5e-50 CYP81F4 "cytochrome P450, family 81, subfamily F, polypeptide 4", cytochrome P450, family 81, subfamily F, polypeptide 4 (.1) AT4G37430 172 / 8e-50 CYP81F1, CYP91A2 "cytochrome P450, family 91, subfamily A, polypeptide 2", CYTOCHROME P450 MONOOXYGENASE 81F1, cytochrome P450, family 91, subfamily A, polypeptide 2 (.1) AT4G37400 170 / 6e-49 CYP81F3 "cytochrome P450, family 81, subfamily F, polypeptide 3", cytochrome P450, family 81, subfamily F, polypeptide 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018711 [exp] 328 / 9e-110 AT4G37370 441 / 5e-151 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10024819 [exp] 227 / 2e-70 AT4G37320 493 / 3e-171 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10024818 [exp] 220 / 1e-67 AT4G37320 480 / 2e-166 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10024820 [exp] 218 / 7e-67 AT5G36220 493 / 2e-171 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10020437 [exp] 207 / 1e-62 AT4G37370 630 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10011958 [exp] 185 / 2e-54 AT5G36220 548 / 0.0 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10018717 [exp] 177 / 2e-51 AT4G37370 533 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10018713 [exp] 163 / 8e-49 AT2G23190 185 / 3e-55 "cytochrome P450, family 81, subfamily D, polypeptide 7", cytochrome P450, family 81, subfamily D, polypeptide 7 (.1) Lus10024816 [exp] 166 / 6e-47 AT4G37370 506 / 2e-176 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G020500 [exp] 321 / 6e-107 AT4G37370 462 / 2e-159 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121100 [exp] 297 / 1e-97 AT4G37370 429 / 2e-146 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020600 [exp] 294 / 1e-96 AT4G37370 479 / 4e-166 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020700 [exp] 285 / 9e-95 AT4G37320 279 / 4e-90 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Potri.014G020432 [exp] 288 / 2e-94 AT4G37370 440 / 4e-151 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121200 [exp] 262 / 5e-84 AT4G37340 465 / 1e-160 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) Potri.002G121400 [exp] 261 / 1e-83 AT4G37370 470 / 1e-162 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121300 [exp] 245 / 4e-79 AT4G37370 308 / 2e-101 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G021800 [exp] 211 / 3e-64 AT4G37360 458 / 1e-157 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) Potri.003G008200 [exp] 208 / 3e-63 AT4G37370 531 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10032857 pacid=23164836 polypeptide=Lus10032857 locus=Lus10032857.g ID=Lus10032857.BGIv1.0 annot-version=v1.0 ATGGCTCCCTTGTATTTCCTCTTCTTCCTCTACTTTCCATTACTCCTATCTCTCTATCCCATTTACTACTACTTCAAATCAACAATCCTAAACCACCCGC CATCTCCATTCCCATCTCTCCCAATCATCGGCCACCTGCACCTCCTCCGCCGTCCACTCCACCGCTCCCTCTCCAACATCTCCGCAAAGCACGGCCCCGT CATCCTCCTCCGATTCGGCATCCGCCGGGTCCTGGTTGTTTCCTCCCCTGACTTGGCAGAACAATGCCTCTCCCAAAACGACGTCGTCTTCGCCAACAGG CCTGCCATGGTGGTCGCTCGCCGCTTCGCCTACAACTGCACCACGCTCGTGTTCTCACGGTACGGCGACCACTGGCGTAACCTCCGCCGAATAGCTTCCA CCGAGCTCCTATCGGCCCACCGAGTCCAATCCCTGGCCGCAATCAGGGGGAACGAGGTGAAATCCGTAATTCGATGGATGTACTTTGGGAAAGAAGAAGT AGTGAACATGAAGGTGTCGTTATTCGAGGTGACGCTGAATGTGATGATGAGCATGATCGCTGGGAAGAGGTACTACGGGGAGAACGTGTCGGACGTTGAG GAGGCGAAGAGGTTTAGGGCGATACACGAAGAGGCTTTCAGGCTGAACGGGGAGACGAATTTGGAGGATTTTTTGCCGTGGGTGAGATCCAAGGATTTGG AGAGGAAGATGATTGAGTGTCACAGGAAGAGAGACGGGTTTTTACAGGGATTAATTGATGAACAGAGGAGAGGAAACAAGAACAACAAGGAGGATGATGA GACGAAGAAGAAGCACAAATGTTTGATTCAGGTTTTGCTGTCTTTGCAAAGGAAGGAGCCAGATTACTATACCGATCAGACTATCAAAGGCTTAATGCTC GTAAGATCCCCCAATCTATCTTATTTTCCATTTCCAATGTTTTTCTTGGATTAA
AA sequence Show only first row Show all	>Lus10032857 pacid=23164836 polypeptide=Lus10032857 locus=Lus10032857.g ID=Lus10032857.BGIv1.0 annot-version=v1.0 MAPLYFLFFLYFPLLLSLYPIYYYFKSTILNHPPSPFPSLPIIGHLHLLRRPLHRSLSNISAKHGPVILLRFGIRRVLVVSSPDLAEQCLSQNDVVFANR PAMVVARRFAYNCTTLVFSRYGDHWRNLRRIASTELLSAHRVQSLAAIRGNEVKSVIRWMYFGKEEVVNMKVSLFEVTLNVMMSMIAGKRYYGENVSDVE EAKRFRAIHEEAFRLNGETNLEDFLPWVRSKDLERKMIECHRKRDGFLQGLIDEQRRGNKNNKEDDETKKKHKCLIQVLLSLQRKEPDYYTDQTIKGLML VRSPNLSYFPFPMFFLD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Lus10032857 [exp]	0	1
AT1G79580	NAC	ANAC033, SMB, N...	NAC (No Apical Meristem) domai...		Lus10009939 [exp]	1.0	0.9356
AT5G09530		PRP10, PELPK1	proline-rich protein 10, Pro-G...		Lus10033898 [exp]	5.3	0.9156
AT1G64480		CBL8	calcineurin B-like protein 8 (...		Lus10001816 [exp]	5.8	0.9246
AT5G17680			disease resistance protein (TI...		Lus10038249 [exp]	6.8	0.8990
AT3G20840	AP2_ERF	PLT1	PLETHORA 1, Integrase-type DNA...		Lus10031831 [exp]	7.4	0.9146
AT1G66540			Cytochrome P450 superfamily pr...		Lus10032856 [exp]	9.9	0.9119
AT1G22340		ATUGT85A7	UDP-glucosyl transferase 85A7 ...		Lus10004670 [exp]	11.2	0.9243
AT1G72230			Cupredoxin superfamily protein...		Lus10027043 [exp]	15.1	0.9145
AT1G51190	AP2_ERF	PLT2	PLETHORA 2, Integrase-type DNA...		Lus10031260 [exp]	15.2	0.9115
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10022065 [exp]	15.7	0.9017

Compare expression of checked genes

Lus10032857 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.