Lus10032858 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10032858 pacid=23164849 polypeptide=Lus10032858 locus=Lus10032858.g ID=Lus10032858.BGIv1.0 annot-version=v1.0
ATGGAGCAAAGGTCTAATAAGAGAGGTGATCACTCTTCCCTAACCTCTGCTTCTGTGATTACAGAGGTCGTCGCCGGTGACCCGATTCAATCCGTCGAGC
TTTCCATGAATCTTGGAATCCGCTTCTTCCCCTCGCCTTTGACTCTACCGCCAGCCGATTCGCATGGGGGAGAAGGCTTCTCCCTCGATCTAAGGCCGTC
GGTCGCGGAACCCCCCTCTAATCCAACGCCGCAATCGCCGTCGCTTCACCTTGTGATACTCCCGGTCGAATCCTCCTTCGATCCTGGTCGATCTCCCATA
ACTTACTCGCCACTCTCCTTCAACCTCTAG
AA sequence
>Lus10032858 pacid=23164849 polypeptide=Lus10032858 locus=Lus10032858.g ID=Lus10032858.BGIv1.0 annot-version=v1.0
MEQRSNKRGDHSSLTSASVITEVVAGDPIQSVELSMNLGIRFFPSPLTLPPADSHGGEGFSLDLRPSVAEPPSNPTPQSPSLHLVILPVESSFDPGRSPI
TYSPLSFNL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10032858 0 1
AT2G01350 QPT quinolinate phoshoribosyltrans... Lus10024868 4.9 0.8804
Lus10039025 6.0 0.8898
AT2G44290 Bifunctional inhibitor/lipid-t... Lus10033076 7.6 0.8825
Lus10023010 15.0 0.8642
AT3G28630 Protein of unknown function (D... Lus10015346 15.3 0.8680
Lus10019560 15.9 0.7908
AT4G37560 Acetamidase/Formamidase family... Lus10011528 16.0 0.8713
AT4G37640 ACA2 calcium ATPase 2 (.1) Lus10002458 17.3 0.8053
AT4G20300 Protein of unknown function (D... Lus10038379 18.3 0.8539
AT4G05220 Late embryogenesis abundant (L... Lus10020066 21.8 0.8445

Lus10032858 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.