Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G01050 40 / 0.0001 zinc ion binding;nucleic acid binding (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042500 [exp] 74 / 1e-18 ND / Lus10027005 [exp] 68 / 2e-16 ND 36 / 9e-04 Lus10021739 [exp] 57 / 1e-11 ND / Lus10034032 [exp] 52 / 4e-09 AT1G06620 374 / 1e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10037828 [exp] 43 / 2e-06 ND / Lus10004431 [exp] 43 / 6e-06 ND / Lus10009076 [exp] 42 / 6e-06 ND / Lus10036275 [exp] 40 / 3e-05 ND / Lus10037474 [exp] 39 / 8e-05 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032865 pacid=23164855 polypeptide=Lus10032865 locus=Lus10032865.g ID=Lus10032865.BGIv1.0 annot-version=v1.0 ATGGTTGTCAACAACTATGAGTTGTGCGTGATTGGAACTTTCAACACGGAACGAGTCTTCAACATGGAGGTGATCAAACATCGGTTGGCCGAGATCTGGC GGCCGGTGAAGTGGATGTCAGTCCGAGATCTCGGCGACAAGCTGTTCTTGTTTAGGTTTTATCACAAACTTGATCTGCGATGGGCGATCGGAAGTGGGCC GTGGACGCATAATGGTATCCATGAGATGAAGGCGGGGGAGGTAAAAGATCTCAAAATCGGCCAGTGGGCAGAACAATATCTAATATTTCATTAA
AA sequence Show only first row Show all	>Lus10032865 pacid=23164855 polypeptide=Lus10032865 locus=Lus10032865.g ID=Lus10032865.BGIv1.0 annot-version=v1.0 MVVNNYELCVIGTFNTERVFNMEVIKHRLAEIWRPVKWMSVRDLGDKLFLFRFYHKLDLRWAIGSGPWTHNGIHEMKAGEVKDLKIGQWAEQYLIFH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G01050			zinc ion binding;nucleic acid ...		Lus10032865 [exp]	0	1
AT2G19380			RNA recognition motif (RRM)-co...		Lus10020460 [exp]	4.5	0.7371
AT3G20800			Cell differentiation, Rcd1-lik...		Lus10015136 [exp]	5.9	0.7602
AT4G34540			NmrA-like negative transcripti...		Lus10012146 [exp]	8.0	0.7468
AT2G25940		ALPHAVPE, ALPHA...	alpha-vacuolar processing enzy...		Lus10033344 [exp]	9.8	0.7468
AT5G19120			Eukaryotic aspartyl protease f...		Lus10039217 [exp]	11.1	0.4792
					Lus10004853 [exp]	11.3	0.7468
					Lus10027667 [exp]	12.6	0.7468
					Lus10003442 [exp]	12.7	0.6787
AT4G18340			Glycosyl hydrolase superfamily...		Lus10031034 [exp]	13.9	0.7468
AT2G28490			RmlC-like cupins superfamily p...		Lus10006420 [exp]	14.8	0.6013

Compare expression of checked genes

Lus10032865 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.