Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G52975 49 / 4e-08 Protein of unknown function (DUF1278) (.1) AT5G52965 48 / 7e-08 Protein of unknown function (DUF1278) (.1) AT3G42565 45 / 1e-06 ECA1 gametogenesis related family protein (.1) AT4G09545 44 / 3e-06 ECA1 gametogenesis related family protein (.1) AT5G48210 43 / 3e-06 Protein of unknown function (DUF1278) (.1) AT3G48675 43 / 6e-06 Protein of unknown function (DUF1278) (.1) AT5G51105 42 / 1e-05 Protein of unknown function (DUF1278) (.1) AT2G14378 42 / 1e-05 Protein of unknown function (DUF1278) (.1) AT4G35165 41 / 2e-05 Protein of unknown function (DUF1278) (.1) AT2G27315 40 / 4e-05 Protein of unknown function (DUF1278) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001307 [exp] 140 / 2e-43 AT5G52975 44 / 2e-06 Protein of unknown function (DUF1278) (.1) Lus10027141 [exp] 138 / 9e-43 AT5G52975 46 / 5e-07 Protein of unknown function (DUF1278) (.1) Lus10019552 [exp] 117 / 7e-35 AT5G51105 37 / 7e-04 Protein of unknown function (DUF1278) (.1) Lus10019549 [exp] 113 / 3e-33 AT5G51105 49 / 4e-08 Protein of unknown function (DUF1278) (.1) Lus10043285 [exp] 79 / 7e-20 AT5G51105 47 / 1e-07 Protein of unknown function (DUF1278) (.1) Lus10019428 [exp] 78 / 2e-19 AT2G14378 50 / 1e-08 Protein of unknown function (DUF1278) (.1) Lus10019101 [exp] 76 / 4e-18 AT2G14378 50 / 3e-08 Protein of unknown function (DUF1278) (.1) Lus10034455 [exp] 72 / 9e-17 AT2G14378 49 / 5e-08 Protein of unknown function (DUF1278) (.1) Lus10028291 [exp] 72 / 2e-16 AT2G14378 44 / 8e-06 Protein of unknown function (DUF1278) (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description
Representative CDS sequence Show only first row Show all	>Lus10032886 pacid=23160423 polypeptide=Lus10032886 locus=Lus10032886.g ID=Lus10032886.BGIv1.0 annot-version=v1.0 ATGGCCATGCAATACTTGATGAACAGAGGACTCGCAGCTTCTACCCTCCTTTTGGTAGCACTACTATTAGTCCTATCATCCACTGCTGCTGCAACATCAA CACCATCGATGTCAGTGTGTAGACCAGGGAAGTTGCCCACAAAACTTGCAGCCAAATGCTGGCTGGCTATTTTCGAGGTCCCGTCCTGCGTGTTTGAGAT AGCGGAGGTGTTCGGAGGAGGTTCCATCTTCAAACTCACTCGCTCTTGCTGCCGGGCGTTCATCGACCTCACATACGACTGCAAGATAGAGGTGTTCCAG CATTCCAAGTTGTTTCCTCCTATTGAAAACTTCTGTGTTACCATTGGTGGTGGAGGTAGCGACCCCCATTCTCCACCTCCTAATTCCCTTTAA
AA sequence Show only first row Show all	>Lus10032886 pacid=23160423 polypeptide=Lus10032886 locus=Lus10032886.g ID=Lus10032886.BGIv1.0 annot-version=v1.0 MAMQYLMNRGLAASTLLLVALLLVLSSTAAATSTPSMSVCRPGKLPTKLAAKCWLAIFEVPSCVFEIAEVFGGGSIFKLTRSCCRAFIDLTYDCKIEVFQ HSKLFPPIENFCVTIGGGGSDPHSPPPNSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G52975			Protein of unknown function (D...		Lus10032886 [exp]	0	1
					Lus10010418 [exp]	1.0	0.9554
AT5G16460			Putative adipose-regulatory pr...		Lus10020213 [exp]	7.6	0.6972
					Lus10011594 [exp]	7.9	0.7874
AT5G04390	C2H2ZnF		C2H2-type zinc finger family p...		Lus10040425 [exp]	9.2	0.7808
					Lus10008653 [exp]	9.4	0.6390
AT1G17930			Aminotransferase-like, plant m...		Lus10005495 [exp]	9.6	0.7874
					Lus10002099 [exp]	11.1	0.7874
AT4G17920			RING/U-box superfamily protein...		Lus10030972 [exp]	12.4	0.7874
AT5G48540			receptor-like protein kinase-r...		Lus10014362 [exp]	13.4	0.6860
AT2G42850		CYP718	"cytochrome P450, family 718",...		Lus10031391 [exp]	13.6	0.7874

Compare expression of checked genes

Lus10032886 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.