Lus10032902 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G54400 89 / 3e-22 HSP20-like chaperones superfamily protein (.1)
AT5G20970 72 / 4e-15 HSP20-like chaperones superfamily protein (.1)
AT5G04890 68 / 2e-13 RTM2 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1)
AT2G27140 65 / 6e-13 HSP20-like chaperones superfamily protein (.1)
AT1G53540 49 / 1e-07 HSP20-like chaperones superfamily protein (.1)
AT1G59860 48 / 5e-07 HSP20-like chaperones superfamily protein (.1)
AT4G21870 47 / 5e-07 HSP20-like chaperones superfamily protein (.1)
AT1G07400 46 / 3e-06 HSP20-like chaperones superfamily protein (.1)
AT3G10680 46 / 6e-06 HSP20-like chaperones superfamily protein (.1)
AT4G10250 44 / 3e-05 ATHSP22.0 HSP20-like chaperones superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015603 197 / 3e-65 ND 36 / 0.004
Lus10008426 86 / 9e-20 AT2G27140 111 / 7e-29 HSP20-like chaperones superfamily protein (.1)
Lus10003356 72 / 5e-15 AT2G27140 103 / 3e-26 HSP20-like chaperones superfamily protein (.1)
Lus10013655 55 / 1e-09 AT1G54400 72 / 3e-16 HSP20-like chaperones superfamily protein (.1)
Lus10028874 55 / 9e-09 AT5G04890 103 / 4e-24 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1)
Lus10008946 50 / 2e-07 AT5G04890 102 / 3e-24 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1)
Lus10004039 45 / 2e-06 AT5G37670 150 / 3e-48 HSP20-like chaperones superfamily protein (.1)
Lus10018882 46 / 7e-06 AT1G76770 153 / 2e-44 HSP20-like chaperones superfamily protein (.1)
Lus10028577 45 / 2e-05 AT1G76770 152 / 3e-44 HSP20-like chaperones superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G054900 119 / 9e-34 AT1G54400 97 / 3e-25 HSP20-like chaperones superfamily protein (.1)
Potri.019G037700 96 / 7e-25 AT1G54400 93 / 5e-24 HSP20-like chaperones superfamily protein (.1)
Potri.013G054800 94 / 3e-24 AT1G54400 98 / 6e-26 HSP20-like chaperones superfamily protein (.1)
Potri.013G054700 89 / 1e-22 AT1G54400 93 / 3e-24 HSP20-like chaperones superfamily protein (.1)
Potri.009G153100 76 / 2e-16 AT2G27140 110 / 5e-29 HSP20-like chaperones superfamily protein (.1)
Potri.004G191200 76 / 2e-16 AT2G27140 106 / 3e-27 HSP20-like chaperones superfamily protein (.1)
Potri.004G191101 73 / 2e-15 AT2G27140 109 / 2e-28 HSP20-like chaperones superfamily protein (.1)
Potri.009G153200 69 / 1e-14 AT2G27140 89 / 9e-22 HSP20-like chaperones superfamily protein (.1)
Potri.004G191000 62 / 1e-12 AT2G27140 81 / 2e-19 HSP20-like chaperones superfamily protein (.1)
Potri.008G013800 64 / 5e-12 AT5G04890 135 / 3e-36 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0190 HSP20 PF00011 HSP20 Hsp20/alpha crystallin family
Representative CDS sequence
>Lus10032902 pacid=23160436 polypeptide=Lus10032902 locus=Lus10032902.g ID=Lus10032902.BGIv1.0 annot-version=v1.0
ATGGCTAGGCAGGGTCTTGTGAAGCGTTCTTACGAGGATTTCGAACCATTTTGCAGGTGGGAAAGAAGCCCTGACGTCGATATTCTCCACGTCCATCTCC
AGGGGTTTAAGAAGCAACAGCTGAGGATACAGCTAAACAGAGTGGGAGGAATGACGATAACAGGGGAACGGTGTCTGGACTCCGATCATAACGATCGATG
GGCGCGATTTGCAAAGGAGACACGTGTCCCCAACGAAATCAACACCAATGCCATTCACGCCAAGCTCTCCTCCGGCATTCTTTCTATCTTCATGCCCAAG
AATGCAACGTTGTTGCTTCAGCAACCCCCAGAATCCGCTGATGGCGAACACAATCAGCCGCAGCAGGTTTCAGAGACAGAGCATCAGTATCAGCAAAAAG
GGGACTCAAAACCAGATGTTGGAGATTCGATCCATCAAAAGGAGTATCATTGGATGATGAAATTGAACGATACGGCGCTGGTGAGGGGCAAATCTGGAAT
CCTAGCTGCTGCTGTTGTTGTAATTGTGGCTGTGGGCGCTGTTCTGGTTGGGTATAGATTGAGAACAAGTTACTCAAATGCTTTGTGGGAAAAATAG
AA sequence
>Lus10032902 pacid=23160436 polypeptide=Lus10032902 locus=Lus10032902.g ID=Lus10032902.BGIv1.0 annot-version=v1.0
MARQGLVKRSYEDFEPFCRWERSPDVDILHVHLQGFKKQQLRIQLNRVGGMTITGERCLDSDHNDRWARFAKETRVPNEINTNAIHAKLSSGILSIFMPK
NATLLLQQPPESADGEHNQPQQVSETEHQYQQKGDSKPDVGDSIHQKEYHWMMKLNDTALVRGKSGILAAAVVVIVAVGAVLVGYRLRTSYSNALWEK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G54400 HSP20-like chaperones superfam... Lus10032902 0 1
AT3G18260 Reticulon family protein (.1) Lus10032451 2.2 0.9778
AT1G35470 SPla/RYanodine receptor (SPRY)... Lus10009316 2.8 0.9769
AT5G36930 Disease resistance protein (TI... Lus10004726 4.0 0.9728
AT1G13920 Remorin family protein (.1) Lus10004665 5.5 0.9741
AT2G42820 HVA22F HVA22-like protein F (.1) Lus10031386 5.9 0.9649
AT1G76770 HSP20-like chaperones superfam... Lus10028577 6.0 0.9625
AT5G36930 Disease resistance protein (TI... Lus10010987 6.5 0.9662
AT5G18970 AWPM-19-like family protein (.... Lus10041238 6.9 0.9635
AT5G36930 Disease resistance protein (TI... Lus10007852 7.1 0.9676
AT1G76770 HSP20-like chaperones superfam... Lus10018882 7.5 0.9466

Lus10032902 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.