Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29660 149 / 1e-48 EMB2752 embryo defective 2752 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015598 [exp] 199 / 3e-68 AT4G29660 150 / 7e-49 embryo defective 2752 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G001800 [exp] 171 / 4e-57 AT4G29660 147 / 1e-47 embryo defective 2752 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032908 pacid=23160316 polypeptide=Lus10032908 locus=Lus10032908.g ID=Lus10032908.BGIv1.0 annot-version=v1.0 ATGGCGAGCTATCTATGGAGGAAATATGCAGATTATCTTTACACAAAATGGGAGAGGACGATTCTGTGGGATATGATTGATCCTTACAGAAGACCCAAAT CATTTACCCCTCTGGTCACTATCTACGTAGCTGCCTTCTACACTGGCGTCGTTGGAGCTGCCATCACCGAGCAGCGATACAAGGAGAAGTATTGGGAAGA TCATCCAGGGGAAACAGTGCCTCTCATGACGCCAAAGTATTATTCTGGTCCCTGGAGAGTATATAGAGGCGAAGCTGTGACACCGAACAATTAG
AA sequence Show only first row Show all	>Lus10032908 pacid=23160316 polypeptide=Lus10032908 locus=Lus10032908.g ID=Lus10032908.BGIv1.0 annot-version=v1.0 MASYLWRKYADYLYTKWERTILWDMIDPYRRPKSFTPLVTIYVAAFYTGVVGAAITEQRYKEKYWEDHPGETVPLMTPKYYSGPWRVYRGEAVTPNN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G29660		EMB2752	embryo defective 2752 (.1)		Lus10032908 [exp]	0	1
AT1G62930		RPF3	RNA processing factor 3, Tetra...		Lus10021074 [exp]	1.0	0.6956
AT1G55170			unknown protein		Lus10041450 [exp]	10.9	0.6953
AT1G22140			unknown protein		Lus10028077 [exp]	12.2	0.6748
AT2G38280		ATAMPD, FAC1	EMBRYONIC FACTOR1, ADENOSINE 5...		Lus10005043 [exp]	14.3	0.6846
AT1G02160			Cox19 family protein (CHCH mot...		Lus10032273 [exp]	31.6	0.6495
AT5G15220			Ribosomal protein L27 family p...		Lus10010822 [exp]	37.3	0.6113
AT1G67620			Lojap-related protein (.1)		Lus10036979 [exp]	38.4	0.6696
AT5G09225			unknown protein		Lus10033507 [exp]	52.3	0.6037
AT5G49550		BLOS2	BLOC subunit 2, unknown protei...		Lus10034392 [exp]	54.1	0.6339
AT5G09920		NRPB4, ATRPB15....	RNA polymerase II, Rpb4, core ...		Lus10005796 [exp]	55.2	0.6263

Compare expression of checked genes

Lus10032908 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.