Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24660 64 / 5e-15 LSU2 response to low sulfur 2 (.1) AT5G24655 62 / 5e-14 LSU4 response to low sulfur 4 (.1) AT3G49570 61 / 2e-13 LSU3 response to low sulfur 3 (.1) AT3G49580 54 / 8e-11 LSU1 response to low sulfur 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015594 [exp] 77 / 5e-20 AT5G24660 79 / 1e-20 response to low sulfur 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G000500 [exp] 67 / 4e-16 AT5G24660 78 / 2e-20 response to low sulfur 2 (.1) Potri.012G004500 [exp] 64 / 8e-15 AT5G24660 81 / 2e-21 response to low sulfur 2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10032912 pacid=23160383 polypeptide=Lus10032912 locus=Lus10032912.g ID=Lus10032912.BGIv1.0 annot-version=v1.0 ATGGCGGAACTGAGGAGGAGAAACGAGGAGCTGGAGAGGGCGCTGAAGGAGAGCAGGGAGAGGGAGGAGATGATGAGGCAAGAGCTCGAGCTGACATGGC GGAGGATGCGAGTGGCGGAGGACGCCGAGGAGAGGCTCTGCTCTCAGCTCGGCGAATTGGAGGCTGAGGCCGTCAATCAAGCGCGTGATTATCACGCTCG TATCATCTCCTTGATGGAGCAGCTTCAGCAAGCTGAGGGTCTCCTCCTCCTCCACTCCTCCTCCTCGTCGTCTCTGGCCTCCTCATAA
AA sequence Show only first row Show all	>Lus10032912 pacid=23160383 polypeptide=Lus10032912 locus=Lus10032912.g ID=Lus10032912.BGIv1.0 annot-version=v1.0 MAELRRRNEELERALKESREREEMMRQELELTWRRMRVAEDAEERLCSQLGELEAEAVNQARDYHARIISLMEQLQQAEGLLLLHSSSSSSLASS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24660		LSU2	response to low sulfur 2 (.1)		Lus10032912 [exp]	0	1
AT5G24660		LSU2	response to low sulfur 2 (.1)		Lus10015594 [exp]	1.0	0.8017
AT1G04770			Tetratricopeptide repeat (TPR)...		Lus10000753 [exp]	5.8	0.7929
AT4G04610		1-Apr, PRH19, A...	PAPS REDUCTASE HOMOLOG 19, APS...		Lus10020040 [exp]	8.8	0.7531
AT5G63010			Transducin/WD40 repeat-like su...		Lus10027338 [exp]	16.0	0.6957
AT4G21990		3-Apr, PRH-26, ...	PAPS REDUCTASE HOMOLOG 26, APS...		Lus10015560 [exp]	35.8	0.7170
AT4G04770		ABCI8, ATNAP1, ...	LONG AFTER FR, ARABIDOPSIS THA...		Lus10035874 [exp]	41.7	0.7238
AT2G37570		SLT1	sodium- and lithium-tolerant 1...		Lus10024406 [exp]	51.4	0.6961
AT4G10770		ATOPT7	ARABIDOPSIS THALIANA OLIGOPEPT...		Lus10028445 [exp]	80.0	0.6659
AT5G06570			alpha/beta-Hydrolases superfam...		Lus10008439 [exp]	86.6	0.6653
AT5G10460			Haloacid dehalogenase-like hyd...		Lus10005305 [exp]	95.0	0.6676

Compare expression of checked genes

Lus10032912 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.