Lus10032914 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G24620 336 / 7e-115 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT4G38660 244 / 7e-80 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT4G24180 231 / 4e-76 ATTLP1 THAUMATIN-LIKE PROTEIN 1 (.1)
AT2G17860 228 / 8e-75 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G19320 226 / 4e-74 Pathogenesis-related thaumatin superfamily protein (.1)
AT4G38670 224 / 8e-73 Pathogenesis-related thaumatin superfamily protein (.1.2.3)
AT1G75800 225 / 1e-72 Pathogenesis-related thaumatin superfamily protein (.1)
AT4G36010 222 / 5e-72 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT1G75050 220 / 6e-72 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75040 219 / 1e-71 PR-5, PR5 pathogenesis-related gene 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015591 438 / 8e-157 AT5G24620 353 / 1e-120 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10041901 246 / 2e-81 AT4G36010 329 / 2e-113 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10028448 245 / 6e-81 AT4G36010 332 / 9e-115 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10032726 238 / 1e-78 AT1G75030 334 / 5e-117 thaumatin-like protein 3 (.1)
Lus10025055 236 / 1e-77 AT4G38660 359 / 6e-125 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10041899 231 / 5e-75 AT4G38660 363 / 2e-125 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10013561 229 / 2e-74 AT4G38660 326 / 2e-112 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10017266 229 / 2e-74 AT4G24180 322 / 7e-111 THAUMATIN-LIKE PROTEIN 1 (.1)
Lus10028447 229 / 3e-74 AT4G38660 359 / 4e-124 Pathogenesis-related thaumatin superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G004800 342 / 9e-119 AT5G24620 358 / 1e-122 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.015G000800 340 / 2e-118 AT5G24620 351 / 4e-120 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.009G132500 251 / 7e-83 AT4G38660 338 / 3e-115 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.004G173200 249 / 8e-82 AT4G38660 357 / 5e-123 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.005G112700 240 / 5e-79 AT4G36010 372 / 3e-130 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.005G112600 240 / 1e-78 AT4G38660 348 / 2e-119 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.005G240900 238 / 6e-78 AT1G75800 398 / 7e-140 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.005G241000 234 / 3e-76 AT4G24180 348 / 5e-121 THAUMATIN-LIKE PROTEIN 1 (.1)
Potri.014G040700 231 / 4e-76 AT1G75030 342 / 5e-120 thaumatin-like protein 3 (.1)
Potri.009G132200 233 / 6e-76 AT4G38670 410 / 2e-145 Pathogenesis-related thaumatin superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0293 CDC PF00314 Thaumatin Thaumatin family
Representative CDS sequence
>Lus10032914 pacid=23160349 polypeptide=Lus10032914 locus=Lus10032914.g ID=Lus10032914.BGIv1.0 annot-version=v1.0
ATGTTCGTTGTCTCGCTCCGCTGTTATTCGTGCTCCTTCACCATCACCAATAACTGCCCTCATCCCATATGGCCCGGAACCCTGGCAGGTTCTGGCACCC
CGCAGCTCCAAACCACAGGGTTCCGGCTGGAGCCAGGGCAGATCGCGAGGATCCCCACCATTCCGGGTTGGTCAGGGCGCATATGGGCTAGGACTGGATG
TTTGTTCGATGAGTCCGGAGTTGGTTCGTGCCAGACTGGCGACTGTGGAGGGAAGCTGCACTGTAGCGGTACCGGGGCCACCCCGCCGGCTTCCCTCTTT
GAGATAACGTTCTCCAAAGGCGTTGACGACAAGGACTTTTACGATGTGAGTATTGTGGATGGGTACAATCTGCCTATGGTTGCTTCGCCCACGGGCTTCC
AGGGTGCTTGCAACACCACCGGCTGCGCTTATGACCTCAACCTTGGTTGCCCGAAGGAGCTTCAGGTGGTTGGCCGAGGAACCAACGGGATAGACGGTGG
AGGAGGAGTGATCGGATGCAAGAGCGCATGCGAAGCATTTGGCCTGGAGCAGTACTGCTGCAGCGGGCAGTACGCCAATCCAACAACTTGCAGGCCATCG
TTCTACTCTTCCATATTCAAGCGAGCTTGCCCCACCGCTTACAGCTATGCCTTTGACGATGGAACCAGCACTTTCACCTGCAAAGCGTCCGACTACTCCA
TCATTTTCTGCCCTTCTAACAACAATAATGGCAATAACAACAACTACAATAATCCCGACCCGACGTAG
AA sequence
>Lus10032914 pacid=23160349 polypeptide=Lus10032914 locus=Lus10032914.g ID=Lus10032914.BGIv1.0 annot-version=v1.0
MFVVSLRCYSCSFTITNNCPHPIWPGTLAGSGTPQLQTTGFRLEPGQIARIPTIPGWSGRIWARTGCLFDESGVGSCQTGDCGGKLHCSGTGATPPASLF
EITFSKGVDDKDFYDVSIVDGYNLPMVASPTGFQGACNTTGCAYDLNLGCPKELQVVGRGTNGIDGGGGVIGCKSACEAFGLEQYCCSGQYANPTTCRPS
FYSSIFKRACPTAYSYAFDDGTSTFTCKASDYSIIFCPSNNNNGNNNNYNNPDPT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G24620 Pathogenesis-related thaumatin... Lus10032914 0 1
AT5G24620 Pathogenesis-related thaumatin... Lus10015591 1.0 0.9770
AT1G60360 RING/U-box superfamily protein... Lus10022967 1.7 0.9677
AT5G18970 AWPM-19-like family protein (.... Lus10021949 2.4 0.9609
AT1G75260 oxidoreductases, acting on NAD... Lus10033210 2.4 0.9692
AT5G20870 O-Glycosyl hydrolases family 1... Lus10043075 4.0 0.9642
AT3G02850 SKOR STELAR K+ outward rectifier, S... Lus10001999 4.5 0.9529
AT2G27140 HSP20-like chaperones superfam... Lus10008426 4.6 0.9580
AT5G54160 ATOMT1 O-methyltransferase 1 (.1) Lus10039864 4.9 0.9480
AT2G30540 Thioredoxin superfamily protei... Lus10040899 5.7 0.9482
AT1G23530 unknown protein Lus10030608 6.3 0.9613

Lus10032914 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.